KEGG   Lactuca sativa (garden lettuce): 111901866Help
Entry
111901866         CDS       T05352                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit 1, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
lsv  Lactuca sativa (garden lettuce)
Pathway
lsv00020  Citrate cycle (TCA cycle)
lsv00190  Oxidative phosphorylation
lsv01100  Metabolic pathways
lsv01110  Biosynthesis of secondary metabolites
lsv01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lsv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    111901866
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    111901866
Enzymes [BR:lsv01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     111901866
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 FAD_binding_3 GIDA DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 111901866
NCBI-ProteinID: XP_023753497
LinkDB All DBs
Position
Unknown
AA seq 628 aa AA seqDB search
MWRCVSRGLRIPSRRSTAGGFLSQRFFASESRVGSSYTIVDHTYDAVVVGAGGAGLRAAI
GLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTVDDWRWHMYDTVKGSDWLGDQDA
IQYMCREAPKAVIELENYGLPFSRTEEGKIYQRAFGGQSLDFGNGGQAYRCACAADRTGH
ALLHTLYGQAMKHNTQFFVEYFALDLIMGSDGSCQGVIALNMEDGTLHRFRSSSTILATG
GYGRAYFSATSAHTCTGDGNAMVARAGLPLEDLEFVQFHPTGIYGAGCLITEGSRGEGGI
LRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPMKDHIYLHLNHLPPEVLK
ERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYHGEVVNKKGDNPDAIVPGLM
AAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEIHKPGEKQAPLSTDAGEKTIAWL
DKIRNSNGSLHTSQIRLNMQRIMQNNAAVFRTQETLEEGCDLIDKAWQSYHDVKLKDRSL
IWNSDLLETIELENLLINACITMHSAEARKESRGAHAREDFTKRDDEKWMKHTLGYWENE
KVRLDYRPVHMNTLDDDVQTFPPKARVY
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgtggaggtgcgtgtcacgtggtcttcgtattccttcccggagatccaccgccggcggc
tttctctcacaacgattcttcgcttccgaatcgcgtgtcggatcatcatatacgatagtt
gatcatacatacgacgccgttgtggttggagctggaggtgccggtcttcgagctgcgata
gggctttccgagcatggatttaatactgcttgcattaccaagctgttccctacacgttct
cacactgttgcagctcagggaggtataaatgctgcattaggaaacatgactgtggatgac
tggaggtggcacatgtatgacacagttaagggaagcgattggctaggtgatcaagatgct
atccaatacatgtgtagagaagcacccaaagcagttatcgaacttgaaaactatggttta
ccattttctcgaactgaagagggcaaaatataccaacgtgcatttggtggtcaaagtctt
gactttggcaatggtggacaagcttatcgttgtgcttgtgctgctgatagaactggtcat
gctttgttgcatacattatatggtcaagcaatgaaacataacacacagttcttcgtggaa
tattttgctttggatctaatcatgggtagtgatggaagctgccaaggtgtcattgcactg
aacatggaggatgggacactacatagattccgttcttcttcaacaatcttggcaactggg
ggttatggtagagcatatttctcagcaacctctgctcatacatgcacaggagatggaaat
gctatggttgcacgtgcaggccttcctcttgaggatcttgagtttgtgcaatttcatccc
actggtatatatggtgctgggtgtcttattactgaagggtctcgtggtgaagggggtatt
ttaaggaatagtgaaggtgagagatttatggagcgttatgctccaactgcaaaggatctt
gcatcaagggatgttgtttcaagatccatgacaatggaaatcagagaaggtcgtggtgta
ggaccaatgaaggatcacatttatcttcacttgaatcacctaccaccagaggttctcaag
gagagactccctggtatctctgaaactgctgccatttttgctggtgttgatgttacaaag
gagcctattccagttttgccaactgtccattacaacatgggtggaatcccaactaattac
catggcgaggttgtaaacaaaaaaggtgataatcctgatgccattgttcctggacttatg
gctgctggagaagcagcatgtgcttctgttcatggtgctaatcgtcttggagcaaattct
cttcttgacattgttgtttttggtagagcttgtgctaatagagttgcagagatccataag
ccaggtgaaaaacaagcaccattgtcaacggatgctggagagaagacaattgcatggtta
gacaaaatcaggaattcaaatggttcacttcatacctctcagatccgattgaacatgcag
cgaatcatgcagaataatgctgctgtctttcgcacacaggagacattagaagaaggttgt
gatctgattgacaaagcatggcagagttatcatgatgtcaaattgaaagatagaagcttg
atttggaactctgacttgctagagacgatagagttggagaaccttttgattaatgcatgc
atcaccatgcattcagctgaagccaggaaagagagtagaggagctcatgctcgtgaagat
ttcacgaaaagagatgatgagaaatggatgaaacacacactcggatactgggagaatgag
aaggtgcgactagactacaggccggttcacatgaacactcttgatgatgatgtgcagact
ttcccaccaaaggctcgcgtgtattaa

DBGET integrated database retrieval system