KEGG   Lactuca sativa (garden lettuce): 111909977Help
Entry
111909977         CDS       T05352                                 

Definition
(RefSeq) DNA ligase 6 isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
lsv  Lactuca sativa (garden lettuce)
Pathway
lsv03030  DNA replication
lsv03410  Base excision repair
lsv03420  Nucleotide excision repair
lsv03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:lsv00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    111909977
   03410 Base excision repair
    111909977
   03420 Nucleotide excision repair
    111909977
   03430 Mismatch repair
    111909977
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:lsv03032]
    111909977
   03400 DNA repair and recombination proteins [BR:lsv03400]
    111909977
Enzymes [BR:lsv01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     111909977
    6.5.1.6  DNA ligase (ATP or NAD+)
     111909977
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     111909977
DNA replication proteins [BR:lsv03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    111909977
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     111909977
DNA repair and recombination proteins [BR:lsv03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     111909977
   NER (nucleotide excision repair)
    Other NER factors
     111909977
   MMR (mismatch excision repair)
    Other MMR factors
     111909977
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DRMBL UBA_4 Lactamase_B_2 RMMBL Lactamase_B
Motif
Other DBs
NCBI-GeneID: 111909977
NCBI-ProteinID: XP_023761536
LinkDB All DBs
Position
Unknown
AA seq 1346 aa AA seqDB search
MASPSSSKPKTLTLDSTALFLQSPQTTCPPLSFSLLSSRSPLPPMPTDFPLSKLIPKTKF
IVDGFRLSGDYSVSYFLSHFHSDHYGGLNANWSKGIIFCSEITARLVIQVLQVSASLVVP
LPLSESVFIDGCEISLVDANHCPGAVQFLFKIPTGDGSCERYVHTGDFRYSVSMKSETVL
NEFTGADAVFLDTTYCNPKYVFPSQQESIDYVVSVINKYSLENDGGLKSVLFLVATYVIG
KEKILLEISRRCKRKIHVDDRKLGILHTLGFGEDEVFTTKESESDVHVIGWNVLGETWPY
FRPNFAKMNEIKDAKGYSKVVGFVPTGWTYEVKHNKFAVRTKDPFEIHLVPYSEHSNYEE
LREYVKFLRPKRVIPTVGVDVENLDGKHVNKMLKHFAGLVDDMAIKQDFLKGFHRGSKGQ
NENLEKDPQKEKEAKNDSFSLCDQKDEHETDEMLQELLDCLPDWVTRAQMMDVLSKSRKN
VVESVSYFYEHETEYYEQIITSVSTSASQENPVEILKEVIAHASSTSSKGFTSPSPPVKS
LLKTDDVSSSKRMTSSTIKQTKSINSPNKKKQSSSSKNTISPNQKRKKINDNISSKKPKI
TSQDGSNGPKQCTITKFFNKLSPVVEISNNDVIKTYKDEVDQFIQIINGNESLHDYATTL
LEETKGDINKALDLYYLKDKQSENQKRIFSNEDTEASQDLISLPPEKYSPIDHACWKDGE
FAPYLHLARTFNLVEGEKGKIKATSMLCNMFRSLLILSPEDVLPAVYLCTNKIAPDHENT
ELNIGGSIVTSAMEEACGTNRLKIRELYNTLGDLGDVAQLCRQTQRLLAPPAPLSIRRVY
SVLREISVQTGNGSTLRKRNLIINLMRSCREMEIKFIVRTLVKNLRIGAMMRTVLPSLAQ
AILLNSSHETTKETLQGLSAAVVEAYNMLPNLDLLIPSLMEKGIQFSSSTLSMLPGIPIK
PMLAKITNGIPQVLKLFQGKAFTCEFKYDGQRAQIHKLPDGSIRVFSRNGDETTSRFPDL
INIINDTCNKDTMSFIIDAEVVAVDRKNGGKLLSFQELSSRDRGSKNSSILVDNIKVDIC
VFVFDVMFANGKQLLGFPLRERRKYMKGLFGDEKSGYFEYSQEITVEMDDADVANEATVS
KMNRFFDEAFHSSCEGLMFKSLDVDAGYLPSKRSDSWLKVKRDYVEGLNDSLDLVPIGAW
YGNGRKAGWYSPFLMACYDPDTEEYQSVCRVMSGFSDAFYKEMKEFFVDEKMMSKNEKPV
YYQTGEEPDMWFSPEVVWEIRGADFTVSPVHHAAMGLVHPSRGISVRFPRFIRARLDKKP
SDCSTNMDIVEMFHLQTWKMDVRGGS
NT seq 4041 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaccatcatcttccaaacccaaaaccctaaccctagattctacagctttattt
ctccaatccccacaaacaacttgtcctccactttctttctctcttctttcctcgcgctct
cctctacctccaatgcccacagattttcccctttccaaacttatccccaaaactaaattt
atcgttgacggcttccgattatccggcgactactccgtatcgtacttcctctcacatttc
cactcagaccactacggcggactcaatgcgaactggtctaaaggaattatcttttgttca
gagattactgcccgccttgttattcaagtacttcaagtttcggcatcattagtggtgcct
ttgcctttgtcggagtcagtttttatcgacggctgtgagatttcactggtcgacgcaaat
cattgccccggtgcagtccagttcttgttcaaaatcccgactggggacgggagttgcgag
aggtatgtgcataccggtgactttaggtattctgtttctatgaaatccgaaactgttctg
aacgaatttacgggtgctgatgccgttttcctggatactacttattgtaatccgaaatac
gtgtttccttcgcaacaggagtccattgattatgtagttagtgtgattaacaagtatagc
cttgagaatgatggtggtttaaagtctgttttgtttcttgttgccacttatgtcattggg
aaagagaaaatcctgcttgagatttcacgtaggtgtaagagaaagatacatgttgatgac
agaaaattgggtattctgcatactctagggtttggagaagatgaagtatttaccactaaa
gaatctgaaagtgatgttcatgttattgggtggaatgttttaggtgaaacctggccttat
ttcagacctaattttgcaaaaatgaatgaaatcaaggatgctaaagggtattctaaggtg
gtgggatttgttccaacagggtggacctatgaagtaaagcataacaagtttgctgtaagg
acaaaagacccatttgaaatacatttagtaccttatagtgaacactcaaactatgaagaa
cttagagagtatgtaaagttcttaagaccaaaacgtgttattccaacagtaggtgtggat
gttgagaatcttgatgggaaacatgttaataaaatgttaaagcattttgcaggattggtt
gatgacatggcaatcaagcaagatttcttgaagggctttcatcgtgggtccaagggacaa
aatgagaatcttgagaaagatccacaaaaggaaaaagaagctaaaaatgattctttttca
ctttgtgatcagaaagatgaacatgaaacagatgaaatgttgcaggagcttcttgattgt
ttgcctgattgggtcactagagcccaaatgatggatgttttaagtaaatcaagaaagaat
gttgttgaatctgtttcttatttttatgaacatgaaactgaatattatgaacagatcatt
acaagtgtatccacttctgcatcacaggaaaatccagttgagattctcaaagaagtcatt
gcacatgcttcatccacctcatccaaaggctttacatcaccttcacctcctgttaaatct
ttattaaaaactgatgatgtttcttcaagtaaaagaatgacatcatccaccattaaacaa
accaaaagtatcaattctccaaacaaaaagaaacaatcaagttcaagtaaaaacaccatt
tctcccaaccaaaagaggaagaagatcaatgacaatatttcaagcaagaagccaaaaatc
acttcacaagatggatctaatggaccaaagcaatgcacaatcactaagttcttcaataaa
ctctcacctgtggttgaaatatccaacaatgatgtcatcaagacttacaaagatgaagta
gatcagttcatacaaatcataaatggcaatgagtcattgcatgattatgctacaaccctt
ttagaggaaacaaagggtgatatcaacaaagctcttgacttgtattacttaaaagataaa
caaagtgaaaatcaaaagaggatcttttctaatgaagacactgaagcatctcaagatctt
atatcacttccacctgagaaatactctcccatagaccatgcttgctggaaagatggagag
tttgctccctatttacatcttgccaggacattcaatttggtggagggcgaaaaaggaaag
attaaagctacatctatgctctgcaatatgtttagaagcttgttaattttgtcacctgag
gatgtgttgccagctgtgtacttgtgcacaaataagattgcccctgatcatgaaaacacg
gaactgaacattggtggaagtattgtgacatcagcaatggaagaggcatgtggaacaaac
agattgaagattcgtgaattgtacaacactttaggtgatcttggtgatgtggctcaacta
tgtcgccagacacaaaggttactagcacctccagctccactctcaatcagacgagtttat
tcagttcttcgagaaataagtgtacaaacaggtaatggaagtacattgcgtaaaagaaac
ctcattattaatctaatgagatcttgtagagagatggagatcaagtttatagtcagaaca
ttggtcaagaatttaagaattggagccatgatgagaactgttcttccttcattagctcag
gctattcttttgaactcttcccatgaaacaaccaaagaaacacttcagggactcagtgca
gcagttgtggaagcatataacatgctcccgaatttagatttgcttattccttctttgatg
gaaaaagggattcagttttcttcatcaacattatcaatgcttccaggcatacccattaag
ccaatgcttgcaaaaattactaatggaatccctcaagtcttgaagctatttcaaggaaaa
gcctttacttgtgaattcaaatatgatggacaacgtgcccaaattcacaaattacctgat
ggatctatacgtgtattttcaagaaatggagatgaaacaacttcaagatttccagattta
ataaatataataaatgatacttgcaataaagataccatgtctttcataattgatgcagag
gtggtggctgttgatagaaaaaatggtggcaagcttctatcttttcaagaactatcttcc
cgtgatagagggagtaaaaattcatctattttagtagataatataaaggttgatatatgt
gtctttgtatttgatgtcatgtttgctaatggaaaacagctgttgggcttccctctgcgc
gagagaagaaaatatatgaaaggtttatttggtgatgaaaagagtggatattttgaatat
tcacaggaaataacagtggagatggatgatgctgacgtggcaaatgaagctacagtgagt
aaaatgaatcggttttttgatgaagcttttcattcatcatgtgagggactcatgtttaag
tctcttgatgttgatgctggttatcttccatcaaagcgttcagattcttggttaaaggtg
aaacgtgattatgtagaagggttaaatgattcccttgacttggttcctattggtgcttgg
tatggaaatggaagaaaagccggatggtatagtccgtttctaatggcgtgctatgatcct
gacaccgaggagtatcaaagtgtttgccgcgtaatgtcgggattctctgacgccttctat
aaagagatgaaagagttttttgttgatgagaagatgatgtcgaaaaatgagaaaccggtg
tattatcaaacgggtgaggagccggatatgtggtttagtcctgaagtggtgtgggagata
cggggggcggacttcaccgtgtcgccggtgcaccatgcggctatgggtttggtgcacccg
tcacgtgggatttcggttagattcccgaggtttattagggcgaggttagataaaaagccg
agtgattgtagcacaaatatggatatagttgaaatgtttcatttacaaacttggaagatg
gatgttcggggtggtagttga

DBGET integrated database retrieval system