KEGG   Lactuca sativa (garden lettuce): 111913209Help
Entry
111913209         CDS       T05352                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase SDP6, mitochondrial
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
lsv  Lactuca sativa (garden lettuce)
Pathway
lsv00564  Glycerophospholipid metabolism
lsv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lsv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    111913209
Enzymes [BR:lsv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     111913209
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 FAD_binding_3 Pyr_redox GIDA Pyr_redox_3 Lycopene_cycl HI0933_like NAD_binding_8
Motif
Other DBs
NCBI-GeneID: 111913209
NCBI-ProteinID: XP_023764697
LinkDB All DBs
Position
Unknown
AA seq 633 aa AA seqDB search
MASFFRARRVGVTAASLAVAVGGSYVALRDPYVSSNDRNGSGTALEAVRRKITDPVAVIP
SRTLQESSLIAANSSNPLDILVVGGGATGCGVALDAVTRGLRVGLVERDDFSSGTSSRST
KLIHGGVRYLEKAVFNLDYGQLKLVFHALEERKQVIDNAPHLCHALPCMTPCFSWFEALY
YWVGLKMYDLVAGRRLLHLSRYYSAQESAELFPTLARKGKDRSLKGTVVYYDGQMNDSRV
NVGLACTAALAGASVLNHAEVVNLIKEDGGDRIIGARIRDNLSGTEFETYAKVIVNAGGP
FCDSVRKLADKDAKPMICPSSGVHIVLPDYYSPEGMGLIVPKTKDGRVVFMLPWLGRTVA
GTTDSNTSITMLPEPHEDEIEFILDAICDYLNVKVRRADVLSAWSGIRPLATDPNAKNTE
SISRDHVVCEDFPGLVTITGGKWTTYRSMAEDAVDAAIKSGNLNPKNTSLTSNIRLVGGE
GWDPAFFTVLAQEYVRMKVAHNGKIVPGVMDTAAAKHLSHSYGTMAEKVASIAQKENLGK
RLAHGYPYLEAEVAYCARNEYCESAVDFIARRSRLAFLDTDAAGRALPRVIQILADEHRW
DKKRQKEEFQTATRFLQSFKSSKNAQFYDGKHI
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atggccagtttttttcgcgctcggcgcgtaggggtcacggctgcctcgctcgccgtcgct
gtaggcggctcctatgtagcactacgtgatccttacgtatcctctaatgatcggaatggc
agtggtacagcgctagaggcagttcggaggaagatcacagaccctgttgcggttatacct
tctcgtaccttacaggagtcatctctgatcgctgctaattcttctaacccgctcgacatt
cttgttgtcggcggaggcgctacaggatgcggcgtcgctcttgatgcggtcaccagagga
ctacgcgttgggcttgtggaacgagatgacttctcttctggaacgtcgtcccgctccacc
aagttaattcacggaggtgttcgctacttggaaaaagcagtattcaatttagattatggg
caactaaagctggtatttcacgcattagaggaacgaaaacaggttatagataacgcccca
cacctatgccatgcattaccctgcatgacaccatgtttcagctggtttgaggcgttatac
tactgggtggggttgaaaatgtatgatctggtagcaggaagacgcctccttcatctttct
agatattactctgcacaggagtccgctgaacttttccctacacttgcaagaaagggtaaa
gacagaagcttgaagggtacagttgtctattatgatggacaaatgaatgattcacgcgtt
aatgttggattagcatgcactgctgctttagctggtgcttctgttcttaatcatgctgaa
gttgtaaatttgattaaagaagatggtggggaccggattataggagcaaggatacgcgat
aacttatctggcacggagtttgagacgtatgcgaaagtgatagtgaatgcgggtggacca
ttttgtgactctgttcgaaaactagctgataaagatgcgaaaccgatgatctgtcctagc
agtggggtccacatagttctccccgactactattctccggaaggaatgggtttgattgtc
ccaaaaacaaaagatggccgtgttgtgttcatgcttccatggctcggaagaacagtcgcg
gggaccaccgattccaacacctccatcaccatgcttccggaacctcatgaagacgaaatt
gaattcatactcgatgccatttgtgattatctcaacgttaaggtaaggcgcgcggatgtt
ttgtctgcttggagtggcatccggcctttggcaaccgatccaaatgcaaagaacacagag
agcatttcaagggatcatgttgtgtgtgaagattttcctggtttggtcaccattactggt
ggaaagtggactacatatcgaagcatggctgaagatgcagttgatgcagctataaagtca
gggaatctaaacccgaaaaacacgagtttgacatcaaatatacgacttgtgggaggagag
gggtgggatcctgcgtttttcacagttctagctcaagaatacgtacggatgaaagttgca
cataatgggaaaattgttcctggagttatggacactgcagctgctaaacatttgtcccat
tcctatggcaccatggctgaaaaagtagcttccatagctcagaaagagaatttggggaaa
cggttggcccatgggtacccgtatcttgaagctgaggtggcgtattgtgcacgaaatgaa
tactgtgaatctgcggttgattttatcgcgaggagatcacggcttgcttttttggatact
gatgcagcaggaagagcactgccacgtgtcattcagatattggcggatgaacatcgttgg
gataaaaagaggcagaaggaagagtttcagactgcaacgcgttttcttcaatcttttaag
tcgtcaaagaatgctcagttttatgatgggaaacatatataa

DBGET integrated database retrieval system