KEGG   Lactuca sativa (garden lettuce): 111913734Help
Entry
111913734         CDS       T05352                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase 2-like
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
lsv  Lactuca sativa (garden lettuce)
Pathway
lsv00620  Pyruvate metabolism
lsv00710  Carbon fixation in photosynthetic organisms
lsv01100  Metabolic pathways
lsv01200  Carbon metabolism
Module
lsv_M00168  CAM (Crassulacean acid metabolism), dark
lsv_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
lsv_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
lsv_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:lsv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    111913734
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    111913734
Enzymes [BR:lsv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     111913734
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2 WbqC MCM_N
Motif
Other DBs
NCBI-GeneID: 111913734
NCBI-ProteinID: XP_023765209
LinkDB All DBs
Position
Unknown
AA seq 965 aa AA seqDB search
MANRNLEKLASIDAQLRLLVPGKVSEDDKLIEYDALLLDKFLDILQDLHGEDLKETVQEC
YELSAEYEGKRDPKKLEELGSVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK
LKKGDFADEANATTESDIEETFKRLVHQLKKSPEEVFDALKNQTVDLVLTAHPTQSVRRS
LLQKHGRIRDCLAQLYTKDITPDDKQELDEALHREIQAAFRTDEIRRTPPTPQDEMRAGM
SYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTR
DVCLLARMMAANMYFSQIEDLMFEMSMWRCNDELRVRAEELYKSARRDVKHYIEFWKQVP
PTEPYRVILGDVRDMLYKTRERSRHLLAHGKSEIPEEAVYTNVEQFLEPLELCYRSLCAC
GDRVIADGSLLDFLRQVSTFGLSLVKLDIRQESDRHTDVLDAITQHLEIGSYREWSEEKR
QEWLLAELSGKRPLFGADLPKTEEIADVLDTFHVIAELPSDCFGAYIISMATSPSDVLAV
ELLQRECHVSKPLRVVPLFEKLDDLEAAPAAVARLFSIEWYKNRIDGKQEVMIGYSDSGK
DAGRLSAAWQLYKAQEELIKVAKEFGVKLTMFHGRGGTVGRGGGPTHLAILSQPPETIHG
SLRVTVQGEVIEQSFGEEHLCFRTLQRFCAATLEHGMNPPISPRPEWRKLMDEIAVYATE
QYRSIVFKEPRFVEYFRLATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTRF
HLPVWLGFGAAFKHAIQKDGKNLQMFQEMYQKWPFFRVTIDLVEMVFAKGDPGIAALNDK
LLVSEDLWSFGEMLRANYEETKAHLLKIAGHKDLLEGDPYLKQRLRLRDSYITTLNVCQA
YTLKRIRDPNYHVTLRPHISKEYSEPSKPADELIHLNPTSEYAPGLEDTLILTMKGIAAG
MQNTG
NT seq 2898 nt NT seq  +upstreamnt  +downstreamnt
atggctaatcggaacttggagaaattggcatcgattgatgctcagttgaggcttttagtt
cctggaaaagtttctgaggatgataagcttattgagtatgatgccttgcttttggataag
tttctcgacattcttcaggatttacatggagaggatctcaaggaaacggttcaagaatgc
tacgagctttctgctgagtatgaaggaaagcgtgacccaaagaagcttgaggaacttgga
agtgtgctcacaagcttagatccaggggactccattgtcatcgcaaaagctttctctcac
atgcttaacttagcaaatctggcagaagaggtccagattgcttacagacgcaggatcaag
ctgaagaagggtgactttgctgatgaagctaatgcaacaactgaatccgacattgaagaa
actttcaagagacttgtgcatcagcttaagaagtcacctgaagaggtttttgacgcactc
aagaatcaaacagttgacttggtcttgactgctcatcccactcaatcagtccgcagatct
ttgcttcagaagcatggaaggattcgtgactgtttggctcagttatataccaaagacatt
acccctgatgataaacaagaactggatgaagctttacatagagaaattcaagctgctttt
cgtacagatgaaatcagaaggaccccaccaactccacaagatgaaatgagagctggaatg
agttacttccatgaaacaatctggaaaggtgtccctaaattcttaagacgtgttgacact
gctcttaagaacattggaatcaatgagcgagttccctataatgcccctctgattcagttc
tcttcatggatgggtggtgatcgtgatggaaatcccagggttacccctgaggtaaccaga
gatgtttgcttgcttgcaagaatgatggctgcaaacatgtacttttcccagattgaagat
ctaatgttcgagatgtctatgtggcgttgtaatgatgaacttcgtgttcgggcagaagaa
ctgtataaatcagcaaggagagatgtgaagcattacatagagttctggaaacaggtacct
ccaactgaaccttatcgtgtgattcttggtgatgtaagagacatgttatataaaactcgt
gaaagatctcgccatcttttagcccatgggaaatctgagatcccagaagaagcagtttac
accaatgttgaacagttcttggaaccccttgagctatgctaccgatcgctatgcgcgtgt
ggcgaccgtgtaatcgcagacgggagtctcctcgacttcctccgccaggtgtcaacattc
ggtctgtccttagtcaaactcgacatccgccaagaatccgaccgccacacagacgtcctc
gacgcgatcacccaacatctagaaatcgggtcctaccgcgaatggtccgaagagaaacgc
caagaatggctcctcgcggagctttccggaaagcgtcccctcttcggcgccgaccttcca
aaaaccgaagaaatcgccgacgtcctcgacaccttccacgtcatcgcggaactcccatcc
gactgcttcggcgcttacatcatctccatggccacgtcaccatccgacgtgttagcagtc
gagcttctccaacgcgagtgccacgtcagcaaaccgctacgtgtggtcccgcttttcgaa
aagctcgacgatctcgaagcggcccccgcagccgttgcgcgcctcttctcgatcgaatgg
tataagaatcggattgacgggaaacaggaagtgatgattgggtattccgattccgggaag
gatgccgggcggctttcggcggcatggcagttgtataaagcgcaagaggagcttataaag
gtggcgaaggagtttggggtgaagcttacgatgtttcatggacgtggtgggacggttggg
cgaggtggtgggcccacgcatcttgctattttgtctcaaccaccggagacgattcatggt
agtttgagagttacggttcaaggggaggttattgagcagtcgtttggtgaagaacatttg
tgttttaggacgttacagagattttgcgcggcgacactcgaacacgggatgaacccgccg
atttcaccgcgaccggaatggcgtaaacttatggatgagattgcggtttatgcaaccgaa
cagtatcgctccattgtattcaaggaaccacgctttgtcgagtacttccgccttgctaca
ccggaattagaatacgggcgtatgaacatcgggagtcgtccatcaaagaggaaaccaagc
ggaggaatagaatcactccgtgcaattccatggatctttgcctggactcaaacccgattc
catctcccggtttggctcggattcggggcggcattcaagcatgccattcaaaaggacgga
aagaatcttcaaatgtttcaagaaatgtaccaaaaatggcccttttttagggtcactatc
gatttggttgaaatggtgttcgctaaaggtgaccccggaatcgctgcactaaatgacaaa
ctacttgtgtctgaagatttatggtcatttggagaaatgttgagagcaaattacgaagaa
accaaagctcatctcctcaagattgcgggacataaggatcttcttgagggtgacccctac
ttgaaacaaagacttcgtctgcgtgactcgtacatcacaaccctaaacgtgtgtcaagca
tacacactaaaaagaatccgtgaccctaactatcatgtcacattaagacctcatatctca
aaggagtattcagagccaagtaaaccagctgatgaacttatccatctgaacccaacaagt
gagtatgcaccgggtcttgaggacactttgatcttgaccatgaagggtattgctgctgga
atgcaaaacaccggttaa

DBGET integrated database retrieval system