KEGG   Lactuca sativa (garden lettuce): 111914647Help
Entry
111914647         CDS       T05352                                 

Definition
(RefSeq) biotin carboxylase 2, chloroplastic
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
lsv  Lactuca sativa (garden lettuce)
Pathway
lsv00061  Fatty acid biosynthesis
lsv00620  Pyruvate metabolism
lsv00640  Propanoate metabolism
lsv01100  Metabolic pathways
lsv01110  Biosynthesis of secondary metabolites
lsv01200  Carbon metabolism
lsv01212  Fatty acid metabolism
Module
lsv_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:lsv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    111914647
   00640 Propanoate metabolism
    111914647
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    111914647
Enzymes [BR:lsv01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     111914647
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     111914647
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C ATP-grasp Dala_Dala_lig_C ATP-grasp_3 RimK ATP-grasp_5
Motif
Other DBs
NCBI-GeneID: 111914647
NCBI-ProteinID: XP_023766112
LinkDB All DBs
Position
Unknown
AA seq 535 aa AA seqDB search
MDSAAMTFCSKPVTSPPGLFIGRSSGIKSSQCSFLVGNKLNFPRQRVQASQKARKSGKHE
GALGATCRAEKILIANRGEIAVRVIRTAHEMGIPCVAVYSTIDKDALHVKLADESVCIGE
APSSQSYLLIPNVLSAAISHGCTMLHPGYGFLAENAVFVEMCRGHGINFIGPNPDSIRVM
GDKATARDTMKNAGVPCVPGGEGLLQSTEEGIKLADEIGYPVMIKATAGGGGRGMRLAKE
RDEFVKLLQQAQSEAAAAFGNDGVYLEKYIQNPRHIEFQVLADKYGNVVHFGERDCSIQR
RNQKLLEEAPSPALTPELRKAMGDAAVAAAASIGYIGVGTVEFLLDERGQFYFMEMNTRI
QVEHPVTEMISSVDLIEEQIRVAMGEKLRMTQDDIVLRGHSIECRINAEDAFKNFRPGPG
RITSYLPSGGPFVRMDSHVYTDYVVPPSYDSLLGKLIVWAPTREKAIERMKRALNDTIIT
GVPTTIEYHKLILEIEDFKNGKVDTAFIPKHEEELAEPQNLVTSSSAKEVANAVA
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atggattccgccgccatgacattttgcagtaaaccagtcacctcccctccgggtttattc
attgggaggtctagtggaatcaagagctcccagtgtagcttcttagtgggaaacaagttg
aactttcctagacaaagagttcaagcttctcaaaaagctcgtaaatcagggaaacatgaa
ggagcacttggtgccacatgtcgtgctgaaaagatcctgatagcaaacagaggggaaatt
gcagtgagagtgattagaactgctcatgagatggggattccctgtgttgcagtctactcc
accattgacaaggatgcacttcatgtgaaactagcagatgagtcagtttgcataggagaa
gctcccagtagtcaatcgtacttgttgatacccaatgtcctatctgctgctatcagtcat
ggatgtacaatgttgcatcctggttatggtttccttgctgagaatgctgtttttgttgag
atgtgtagaggacatggaatcaacttcattggcccaaatcctgacagcattcgtgtgatg
ggggacaaagcaactgctagagataccatgaagaatgctggtgttccatgtgtacctgga
ggtgaaggtctattacagagcacagaggaaggcatcaagcttgctgatgagattggatac
cctgtcatgattaaggccacagcaggtggtggtggtcgtggaatgcgtcttgcaaaagaa
cgtgatgaatttgtaaaattgttgcagcaagcccagagtgaggctgcagctgcatttgga
aatgatggtgtttatttggagaaatacatccaaaacccaaggcacattgagttccaggtt
cttgcagataaatatggtaatgttgttcactttggagagcgtgactgcagtattcagagg
aggaaccagaagttgcttgaagaagcaccgtcgcctgcattaaccccagagctaaggaaa
gcgatgggtgatgcagcagttgctgcagcagcatcaattgggtacattggtgttggtact
gtagagtttcttttggatgaaagaggtcaattttacttcatggaaatgaacaccagaatc
caggtcgagcatccagtaaccgaaatgatatcttcagtcgacttaatagaggagcaaatt
cgtgttgctatgggtgaaaaactccgtatgactcaggatgatattgtgcttagaggacac
tcgattgaatgccgtatcaatgcagaagatgctttcaagaatttcagaccaggaccaggg
agaattacatcttacttgccatctggaggtccatttgtgagaatggatagtcacgtttat
accgattatgttgttccaccaagctatgattctctacttggaaagcttatcgtatgggcc
ccaacaagagaaaaggcaattgagcgcatgaagagggctcttaatgataccattatcaca
ggtgttccaactacaatcgagtaccacaagctaattcttgaaatcgaagacttcaaaaat
ggaaaagttgatactgcttttattccaaagcacgaggaggaattagccgagccacagaac
ttggttacctcatcttctgctaaagaagtcgcaaatgctgtagcttaa

DBGET integrated database retrieval system