KEGG   Lactuca sativa (garden lettuce): 111917716Help
Entry
111917716         CDS       T05352                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit 3, mitochondrial
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
lsv  Lactuca sativa (garden lettuce)
Pathway
lsv00020  Citrate cycle (TCA cycle)
lsv00190  Oxidative phosphorylation
lsv01100  Metabolic pathways
lsv01110  Biosynthesis of secondary metabolites
lsv01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lsv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    111917716
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    111917716
Enzymes [BR:lsv01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     111917716
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 CCER1 Fer4_7 Fer2
Motif
Other DBs
NCBI-GeneID: 111917716
NCBI-ProteinID: XP_023769151
LinkDB All DBs
Position
Unknown
AA seq 306 aa AA seqDB search
MGLKSTGRKWLTEGYKKVVGGLVNRKQQRFGVLEGHPVGQDHAQAAAEYHQTLKDNIKTL
KKEFKVYRWNPDHPSQKPFLQSYFLDLTTCGPMVLDALQKIKSEDDSTLSYRRSCREGIC
GSCAMNIDGTNTVACLKPIDTDTSKATYITPLPHMYVIKDLVVDLTNFYHQYKSIEPWLK
TKKPPPDGREYRQTPAQRKKLDGLYECILCACCSTSCPSYWWNPEEFDGPAALLHAHRWI
SDSRDDYTEERLQALTENDKRLYRCRIIKNCTATCPKSLNPALAIRQMAAMKSGNRFSAS
IAETKI
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggggttgaagagcaccggccggaagtggttgacggaaggatacaagaaggtggtgggt
ggtctggtgaaccgaaaacagcagaggttcggagttcttgaaggccacccggttggtcaa
gaccatgctcaggcagcagccgaatatcatcaaaccctaaaagacaacatcaaaactctc
aaaaaagagttcaaagtctacagatggaaccccgatcatccctcccaaaaacccttcctc
caatcctacttcctcgatctcaccacatgtggccccatggttttggacgcactacagaag
ataaaatcagaagatgattcaacattgagttacagaaggtcatgcagagaaggaatatgt
ggttcgtgtgccatgaacatcgatggaaccaacacagtcgcatgccttaagccaatcgat
acagacaccagtaaggctacatatatcactcctttaccacacatgtatgtcatcaaagat
ctggttgtcgatcttaccaacttctatcatcagtacaagtcgattgagccatggttgaag
acgaagaagcctccaccagatggaagagaatacagacaaacaccagcacaaagaaagaaa
ctagatggattatacgagtgcatactgtgtgcttgttgtagcacgtcttgtccgtcttac
tggtggaacccggaggagtttgacggacctgcggcgttgttacacgctcaccgttggatc
tccgacagtcgcgatgactacacggaggagagattgcaggcgttgacggagaatgacaaa
cggttgtacagatgtagaattataaagaattgtacagcaacatgtcctaaaagcttgaat
cctgcgcttgctattcgtcaaatggcggctatgaagtctgggaatcgattttctgcaagt
atagcagagactaaaatatga

DBGET integrated database retrieval system