KEGG   Lactuca sativa (garden lettuce): 111918769Help
Entry
111918769         CDS       T05352                                 

Definition
(RefSeq) 6-phosphogluconate dehydrogenase, decarboxylating 2, chloroplastic
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
lsv  Lactuca sativa (garden lettuce)
Pathway
lsv00030  Pentose phosphate pathway
lsv00480  Glutathione metabolism
lsv01100  Metabolic pathways
lsv01110  Biosynthesis of secondary metabolites
lsv01200  Carbon metabolism
Module
lsv_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
lsv_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:lsv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    111918769
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    111918769
Enzymes [BR:lsv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     111918769
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     111918769
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 6PGD NAD_binding_2 3HCDH_N
Motif
Other DBs
NCBI-GeneID: 111918769
NCBI-ProteinID: XP_023770159
LinkDB All DBs
Position
Unknown
AA seq 487 aa AA seqDB search
MEAAALSRIGLAGLAVMGQNLALNVAEKGFPISVYNRTTSKVDETLDRAHNEGQLPLTGH
YTPRDFVLSIQKPRSVIILVKAGAPVDQTIEALAAHMEPGDTIIDGGNEWYENTERRIVE
AENRGLLYLGMGVSGGEEGARNGPSLMPGGSYEAYNNIKDIVEKVAAQVEDGPCVTYIGE
GGSGNFVKMVHNGIEYGDMQLISEAYDVLKNVGGLSNTELAEIFDEWNRGELESFLIEIT
ADIFKVKDEHGEGELVDKILDKTGMKGTGKWTVQQAAELSVAAPTIAASLDCRYLSGLKD
EREDAARILAAAGLKEEVGTVRSGIDKKRLIDDVRQALYASKICSYAQGMNLLRVKSSEK
NWNLDFGELARIWKGGCIIRAVFLDRIKKAYQRNPNLASLLVDPDFAKEMVQRQAAWRRV
VGLAISAGISTPGMCASLTYFDTYRRARLPANLVQAQRDLFGAHTYERIDREGAFHTEWT
KLARKKA
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggaggctgctgctctctcgcgtatcggcctcgccggacttgctgtcatgggccaaaac
ctagcgctcaacgtcgcagagaaagggtttccgatctccgtttacaacaggactacctcg
aaagtcgatgagactctagatcgagctcataatgaaggccagcttccgttaactggccac
tacactcctcgcgacttcgttctttcgatccagaagccccgatctgtcatcatccttgtg
aaggcaggcgcgccggttgaccagacgattgaggcgttggcggctcatatggaaccagga
gacacgatcatcgacggaggtaacgagtggtacgagaacaccgagcgacgaatcgtcgaa
gcggaaaatagaggattgctttatctaggaatgggagtctccggcggcgaagaaggggcg
cgaaatgggccgtctttgatgccaggtgggtcttacgaagcttataataacattaaagat
atcgttgaaaaagttgctgctcaggttgaagatggaccttgtgttacatacattggagaa
ggcgggtctggtaacttcgttaaaatggttcataatggaatcgaatatggtgatatgcag
ttgatttctgaagcttatgatgttttgaaaaacgttggtgggttaagcaacaccgaatta
gctgaaatctttgacgaatggaacagaggcgaattagaaagcttcttgattgaaatcaca
gctgatatcttcaaggtgaaagatgaacatggtgaaggtgagttagtggacaaaattctt
gacaaaacagggatgaaaggaaccggtaaatggacagtccagcaggctgctgaactctcc
gtcgccgcccccaccatcgccgccagtcttgattgccggtatctgagcgggttaaaggac
gaacgagaggatgcggccaggatactggcggcagcagggctgaaggaggaggtgggaaca
gtgagaagtgggattgacaagaagagattgatagatgatgtgaggcaagctttatacgct
tctaagatctgtagttatgctcaaggaatgaatcttttaagggtaaaaagcagtgaaaag
aactggaacttggattttggagaattagctagaatttggaaaggagggtgtattatcaga
gctgtgttcttggacagaatcaagaaagcataccagcggaaccctaatcttgcaagcttg
ctggtggaccctgatttcgcgaaggaaatggtgcagaggcaggcggcatggcggagggtg
gtggggctggcaatatccgccggaatcagtacacctggcatgtgtgccagcttgacatat
tttgacacgtataggcgtgctaggcttcctgcaaatcttgttcaagctcaaagggacttg
tttggagctcatacttatgaaaggattgatcgtgaaggagcttttcacactgaatggaca
aagcttgcgaggaagaaggcttga

DBGET integrated database retrieval system