KEGG   Lactuca sativa (garden lettuce): 111920699
Entry
111920699         CDS       T05352                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase SDP6, mitochondrial-like
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
lsv  Lactuca sativa (garden lettuce)
Pathway
lsv00564  Glycerophospholipid metabolism
lsv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lsv00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    111920699
Enzymes [BR:lsv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     111920699
SSDB
Motif
Pfam: DAO DAO_C FAD_binding_2
Other DBs
NCBI-GeneID: 111920699
NCBI-ProteinID: XP_023772035
LinkDB
Position
Unknown
AA seq 626 aa
MARLFRARRVSVTAGALAVAVGGSYMTLRDTSVSASDRGGGTALEALRRRITDPAAVVXX
XXXXXXXXXXXXXXXXXXXXXGCGVALDAATRGLRVGLVEREDFSSGTSSRSTKLIHGGV
RYLEKAVFNLDYGQLKLVFHALLERKQVIDNAPHLCHALPCMTPCFGWFETVYYWVGLKM
YDLVAGRHLLHLSRYYSAQESSELFPTLARKGNDRSLKGTVVYYDGQMNDSRVNVGLACT
AALAGAAVLNHAEVVELLRENGKGRVIGARIRDNLSGKEFDSYAKVIVNAGGPFCDSVRK
LADKDAKSMICPSSGVHIVLPDYYSPQGMGLIVPKTKDGRVVFMLPWLGRTVAGTTDSNT
KITMLPEPREDEIEFILDAIRDYLNVKVRRMDVLSAWSGIRPLAMDPNAKNTESISRDHV
VCEDFPGLVTITGGKWTTYRSMAEDAVDAAIKSGKLNPLNKCLTSNLCLVGGDGWDPAFF
TVLAQEYVRMKNTQNGTLVRGVMDTAAAKHLSHSYGTMSQRVASIAQNENLGKRLAHGYP
YLEAEVAYCARNEYCESAVDFIARRSRLAFLDTDAANYALPRVIELLAAEHNWDKSRQNE
EMETAMKFLETFRSSKNAHFHDGWHT
NT seq 1881 nt   +upstreamnt  +downstreamnt
atggcgaggctttttcgcgctcggcgcgtaagcgtcaccgccggtgcacttgccgtcgcc
gtcggcggttcttatatgacactacgtgatacctccgtatctgcaagcgaccgtggaggt
ggtacagcgttggaggcgttacggaggaggatcaccgaccctgccgcggttgttnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nncggctgcggcgtcgctcttgatgccgccaccagaggcctacgcgtcggccttgtggaa
cgagaggacttctcttccggtacctcgtcgcggtccacgaagcttattcacggaggagtt
cgatacttggagaaagctgtgttcaatttagattatgggcagctaaagttagtttttcat
gctctgttggagcgtaaacaggttattgataatgctccacacctgtgtcatgctttacct
tgcatgacaccatgttttggttggtttgagacagtgtactattgggtgggtctgaaaatg
tatgatctagttgcaggaagacatttactgcatctttcaaggtattattctgcacaagag
tcttctgaacttttccccacacttgcaagaaagggtaacgatagaagtttgaaaggaaca
gtggtgtattatgatggacaaatgaatgattcacgggttaatgttggattagcttgcact
gctgctttagctggtgcagctgttcttaatcatgctgaggttgtggaattgttgagagaa
aatggtaaagggagggttattggagcacgaattcgggataacttatcaggaaaagagttt
gatagctacgcaaaagttattgtgaatgcgggtggaccattttgtgactcggtaagaaaa
ctagccgataaagatgcaaaatccatgatttgccctagcagtggggtccacattgtgctt
ccagactattattctccacaaggaatgggattgatagtccctaaaacaaaagacgggcgc
gttgtattcatgctcccatggttggggagaacagttgctgggacaaccgactccaacacc
aaaattactatgttaccagaacctcgtgaggatgaaatcgagttcattctagatgccatc
cgtgattatcttaatgttaaggtccggcgtatggatgttctatctgcttggagtgggatt
cggccactagcaatggatccgaatgcaaagaacacagaaagcatttcaagggatcacgtt
gtatgtgaagatttccctggtttggtcactattactggtggaaagtggactacatataga
agtatggctgaagatgcagtggatgcagctattaagtcggggaaattaaatccattgaat
aaatgtctaacatccaatttatgtcttgtgggtggagacgggtgggacccagcatttttc
actgtgcttgctcaagaatatgtacgcatgaagaatacacaaaacgggacattagttcgt
ggagtgatggacactgctgcagcaaaacatttgtctcactcttatggtaccatgtcccaa
agagtagcttccattgctcagaatgaaaatctagggaagaggctggcccacgggtacccg
tatcttgaagctgaggtggcatactgtgctcggaacgaatactgtgaatctgcggtggat
tttattgctagaagatctagacttgctttcctggacacagatgcagcaaactatgcattg
ccacgtgtcatcgagctattggctgctgaacacaattgggacaaatcaaggcaaaatgaa
gagatggaaacggcgatgaagtttctagagacttttaggtcgtccaagaacgctcacttc
catgacggatggcatacataa

DBGET integrated database retrieval system