KEGG   Lachancea thermotolerans: KLTH0D14476gHelp
Entry
KLTH0D14476g      CDS       T01117                                 

Definition
(RefSeq) KLTH0D14476p
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
lth  Lachancea thermotolerans
Pathway
lth00020  Citrate cycle (TCA cycle)
lth00480  Glutathione metabolism
lth01100  Metabolic pathways
lth01110  Biosynthesis of secondary metabolites
lth01130  Biosynthesis of antibiotics
lth01200  Carbon metabolism
lth01210  2-Oxocarboxylic acid metabolism
lth01230  Biosynthesis of amino acids
lth04146  Peroxisome
Module
lth_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lth_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:lth00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KLTH0D14476g
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    KLTH0D14476g
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    KLTH0D14476g
Enzymes [BR:lth01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     KLTH0D14476g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 8295583
NCBI-ProteinID: XP_002553339
UniProt: C5DFE6
LinkDB All DBs
Position
D:complement(1184813..1186075)
Genome map
AA seq 420 aa AA seqDB search
MFRRHLSSLPKIKVKSPLVELDGDEMARVIWARIRSRLVLPFLDVDLHYYDLSIQNRDRT
EDAVTHDAAHAIARHGVGVKCATITPDEARVAEFGLKRMWRSPNGTIRNILGGTVFREPI
VIPRVPRLVPGWQQPIIIGRHAHGDQYRATDTLVPGPGKLELVFRPAGRGAAAARTLHVH
DFEGAGVALAMYNTDESIRGFAHASFRLALSKQLNLFLATKNTILKQYDGRFKDLFQQLY
DAEYREAFERAGISYEHRLIDDMVAQMIKSRGGFVLALKNYDGDVQSDIVAQGFGSLGLM
SSVLITPDGNAFESEAAHGTVTRHFRLHQQGKETSTNSIASIFAWTRGLARRADLDGTPA
VADFAHALEGATLRTVQDDAIMTKDLALACGKTDRTAYVTTDEFLQAVEDRLQRELRSIH
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgttcaggagacacctcagctcgctgcccaagatcaaggtcaagtcgccgctcgtggag
ctcgacggcgatgagatggcgcgcgtcatctgggcacgcatccggtcccggctcgttctg
ccgttcctcgacgtggacctgcactactacgatctctcgatccagaaccgcgaccgcaca
gaggatgccgtcacacatgatgcggcgcacgcgatcgcgcggcacggcgtgggcgtgaag
tgcgcgacgatcactccggacgaggcacgtgtcgcggagttcgggctcaagcgcatgtgg
cggtcgcctaacggcacaatacgcaacatcctgggcggcaccgtgttccgcgagcccatt
gtgatcccgcgcgtgccgcggctggtgcccggctggcagcagcccatcattatcggtcgg
cacgcgcacggcgaccagtaccgggccacggacaccttggtgcccgggcctggcaagctg
gagctcgtgttccggcctgcgggccgcggcgcggccgcggcccgcacgctgcacgtgcac
gacttcgagggcgccggcgtcgcgctggcgatgtacaacacggacgagtcgatccgcggc
ttcgcgcacgcgtcgttccggctcgcgctctccaagcaactcaacctcttcctcgcgacc
aagaacacgatcctcaagcagtacgacggccgcttcaaggacctgttccagcagctttac
gacgcggagtaccgcgaggcgttcgagcgcgcaggcatttcatacgagcaccgcctcatc
gacgacatggtcgcgcagatgatcaagtcgcgcggcggctttgtgctcgcgctcaagaac
tacgacggcgacgtgcagtccgacatcgtcgcgcagggcttcggctcgctgggcctcatg
agctcggtactcatcactcccgacggcaatgcattcgagagcgaggccgcccacggcaca
gtcacccgccacttccgcctccaccagcagggcaaggagacctcgaccaactccatcgcg
tccatcttcgcgtggacccgcggcctcgcccgccgcgcggacctcgacggcacccctgcc
gttgcggactttgcccacgcgctggagggcgccacgctacgtacggtccaggacgacgcc
atcatgaccaaggacttggccctggcctgcggcaaaaccgaccgcaccgcctacgtgacc
acggacgagttcctacaggccgtcgaagacaggcttcagcgtgagctgcgctccatccat
tga

DBGET integrated database retrieval system