KEGG   Lachancea thermotolerans: KLTH0F19668gHelp
Entry
KLTH0F19668g      CDS       T01117                                 

Definition
(RefSeq) KLTH0F19668p
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
lth  Lachancea thermotolerans
Pathway
lth04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:lth00001]
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    KLTH0F19668g
Enzymes [BR:lth01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     KLTH0F19668g
Chromosome and associated proteins [BR:lth03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     KLTH0F19668g
   HDAC complexes
    Sin3A-HDAC complex
     KLTH0F19668g
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    KLTH0F19668g
  Chromatin remodeling factors
   NuRD complex
    KLTH0F19668g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 8293278
NCBI-ProteinID: XP_002555042
UniProt: C5DJW6
LinkDB All DBs
Position
F:1595709..1597007
Genome map
AA seq 432 aa AA seqDB search
MVYQQLPFDDLKVKSTNKERVAYFYDSDVSNYSYGASHPMKPARIRMAHSLVMNYGLYKK
MEIYRAKPATKQEMCQFHSDEYIDFLSRVTPDNLEMFQKESVKFNVGDDCPVFDGLYEYC
SISGGGSMEGAARLNRGKCDVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHPRV
LYIDIDVHHGDGVEEAFYTTDRVMTCSFHKYGEFFPGTGELRDTGVGKGKYYSVNVPLRD
GIDDTTYKSVFEPVIGKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVNYVKS
FGIPMLVVGGGGYTMRNVARTWAFETGLLNNVILDQELPYNDYYEYYGPDYELDVRPSNM
FNVNTPEYLDKILTGIFSNLENTKHAPSVQINNVPRDLEDHGDVEEDTADAKDTRGGSQY
ARDQLIEKDNEY
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggtgtatcaacaactcccctttgacgatctgaaggtgaaatccacgaataaagaaaga
gttgcatacttctatgattcagatgtgtcgaattatagttatggtgcatcgcaccctatg
aaacctgcaaggattcggatggcgcacagtttggttatgaattatggactttacaagaaa
atggagatttaccgagcaaagcccgccactaaacaggaaatgtgccagttccattcggat
gaatacatagattttctgtctcgagtaacccctgataatctggaaatgttccagaaagag
agcgtgaagttcaatgtgggagacgactgcccagtgtttgatgggctatacgaatactgt
agtatttccggtggagggtcgatggagggcgcagcgcgtcttaaccgcggaaagtgcgat
gtggccatcaactatgcaggaggcttgcatcatgctaaaaaatcagaggcatccgggttt
tgctaccttaacgatattgtgctgggaattatcgaacttctacgctatcacccaagagta
ctttatattgatattgatgtgcatcatggtgatggtgtagaggaggctttttacacaact
gatcgggtaatgacgtgctctttccataagtacggtgaatttttcccgggtaccggtgag
ctgcgggatacaggcgtgggaaaagggaaatactattctgtcaatgttcctttgcgagac
ggaattgatgacacaacttacaagtcggtttttgagccagtgattggcaaaataatggaa
tggtatcagccctctgctgtggttctccaatgtgggggcgattctctttctggggatcgt
ctaggttgctttaacttatccatgcgtggccatgctaactgtgtcaattatgttaagtcc
ttcgggattcccatgttagttgtgggaggtggtggctacaccatgagaaatgttgcccgt
acatgggcgtttgaaactggtctgctaaacaacgtcatactcgaccaagagcttccttac
aacgactactatgaatattacggcccagactatgaactggatgtaagaccatcaaacatg
ttcaacgttaacacaccagagtacctagacaagatcttgacaggaatttttagtaacctc
gaaaatactaagcatgctcctagtgtccaaattaataatgtgccgagagacttagaggat
cacggagacgtggaggaagacacagcagatgccaaggatacgagaggtggctcgcagtat
gctagagatcagctgatcgagaaagataatgagtattag

DBGET integrated database retrieval system