KEGG   Lachancea thermotolerans: KLTH0G00440gHelp
Entry
KLTH0G00440g      CDS       T01117                                 

Definition
(RefSeq) KLTH0G00440p
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
lth  Lachancea thermotolerans
Pathway
lth00010  Glycolysis / Gluconeogenesis
lth00051  Fructose and mannose metabolism
lth00052  Galactose metabolism
lth00500  Starch and sucrose metabolism
lth00520  Amino sugar and nucleotide sugar metabolism
lth01100  Metabolic pathways
lth01110  Biosynthesis of secondary metabolites
lth01130  Biosynthesis of antibiotics
lth01200  Carbon metabolism
Module
lth_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lth_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lth00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KLTH0G00440g
   00051 Fructose and mannose metabolism
    KLTH0G00440g
   00052 Galactose metabolism
    KLTH0G00440g
   00500 Starch and sucrose metabolism
    KLTH0G00440g
   00520 Amino sugar and nucleotide sugar metabolism
    KLTH0G00440g
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    KLTH0G00440g
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lth04131]
    KLTH0G00440g
Enzymes [BR:lth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     KLTH0G00440g
Membrane trafficking [BR:lth04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    KLTH0G00440g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 DUF2294
Motif
Other DBs
NCBI-GeneID: 8293316
NCBI-ProteinID: XP_002555058
UniProt: C5DLG0
LinkDB All DBs
Position
G:28632..30089
Genome map
AA seq 485 aa AA seqDB search
MVHLGPKKPPMRKGSMIDVPKNLMEQIQSLEEQFTVSGEKLKEVTKHFVGELNKGLSKKG
GNIPMIPGWVMEFPTGQETGDYLAIDLGGTNLRVVLVRLLGNHKFDTTQSKYKLPDHIRT
SSSEELFSFIADSLKTFVDEEFPEGVTEPLPLGFTFSYPCSQDKVNEGFLQRWTKGFDIE
GVEGEDVVPMLQEQLVKRKIPIDVVALINDTTGTLVASMYTDAETRMGCIFGTGVNGAYF
DVVSDIEKLEGRLPSDITSDLPMAINCEYGSFDNELVVLPRTKYDIIVDKQSPRPGQQSF
EKMTSGYYLGELLRLILLDLQQQGLIFEGQDLTKLQKPYVMDTSYPARIEEDPFENLEDT
YDIFKNELGVETTGGERKLIRRACELIGTRASRMSMCGIGAVCTKRGYKTAHIAADGSVF
NKYPEFKERAAAGLRDIFDWEPRQNIEEYPIVIVAAEDGSGAGAAIIAALTQKRLAAGKS
VGVAK
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggttcacctaggtcccaagaagcctcctatgagaaaggggtctatgatcgacgtccca
aagaacttgatggaacaaattcaatcccttgaagaacagttcactgttagcggtgagaaa
ttgaaggaagtcaccaagcactttgtgggtgagctaaacaagggtctctccaagaaaggt
ggtaacatccctatgattccaggctgggttatggaattccccaccggccaagaaactggt
gactacctagctattgacctcggtggtactaacttgagagttgttttggtcagactattg
ggtaaccacaagtttgacactactcaatctaagtacaagcttcctgaccacatcaggact
tcttcttccgaagaactcttctcattcatcgctgacagtcttaagactttcgttgatgag
gagttcccagagggcgttacagagcctttgcctctaggtttcactttctcttacccatgc
tcccaggacaaggttaacgaaggtttcttgcagagatggaccaagggtttcgacattgaa
ggtgttgaaggtgaagacgttgtgccaatgttgcaggagcaattggtcaagaggaagatc
ccaattgacgttgttgctttgatcaacgacactaccggtactttggttgcttccatgtac
actgatgccgagaccagaatgggttgcatctttggtacaggtgtgaacggtgcgtacttc
gatgtcgtttccgacattgagaagttagagggaagattgccttctgacatcacaagtgac
ctgccaatggccatcaactgtgaatacggttcttttgacaacgagttagttgttctacca
agaacaaagtacgacatcatcgttgacaaacaatctcctagacccggccaacaaagtttc
gagaagatgacctccggttactacttgggtgaacttttgagattgattcttttggacctg
cagcaacaaggcctaatcttcgaagggcaagacctaactaagctgcagaagccttacgtt
atggacacctcttacccagccagaattgaggaggacccattcgagaacttggaagacact
tacgatattttcaagaacgaactcggagtcgagaccactggcggagagcgtaagttgatt
agaagagcttgcgagctgattggtactagagcctctagaatgtctatgtgcggtattggt
gccgtgtgcaccaaaagaggttacaagaccgctcacattgctgccgatggctccgttttc
aacaaatacccagagtttaaggagagagccgctgctggcttgagagacatctttgactgg
gagcctcgtcagaacattgaagagtaccctattgtcattgttgccgccgaggatggatcc
ggtgctggtgccgccatcattgctgctttgactcaaaagagactggctgctggcaagtct
gtgggtgttgccaagtaa

DBGET integrated database retrieval system