KEGG   Lachancea thermotolerans: KLTH0G07480gHelp
Entry
KLTH0G07480g      CDS       T01117                                 

Definition
(RefSeq) KLTH0G07480p
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
lth  Lachancea thermotolerans
Pathway
lth00020  Citrate cycle (TCA cycle)
lth00190  Oxidative phosphorylation
lth01100  Metabolic pathways
lth01110  Biosynthesis of secondary metabolites
lth01130  Biosynthesis of antibiotics
lth01200  Carbon metabolism
Module
lth_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lth_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
lth_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:lth00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KLTH0G07480g
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    KLTH0G07480g
Enzymes [BR:lth01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     KLTH0G07480g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 Thi4 FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 8293633
NCBI-ProteinID: XP_002555363
UniProt: C5DMB5
LinkDB All DBs
Position
G:complement(605253..607166)
Genome map
AA seq 637 aa AA seqDB search
MLSVRQMKLSTSRRLFSRTSRALRAFAANGDVDGQNSAPFGGQYQVVDHEYDCLVVGAGG
AGLRAAFGLAEAGYKTACISKLFPTRSHTVAAQGGINAALGNMHKDNWKWHMYDTVKGSD
WLGDQDSIHYMTREAADSIIELEHFGVPFSRTEEGRIYQRAFGGQTKENGKGGQAYRTCA
VADRTGHALLHTLYGQALRHNTHFFIEYFALDLLVHNGEVVGVIAYNQEDGTIHRFRAHK
TVIATGGYGRAYFSCTSAHTCTGDGNAMVSRAGFPLQDLEFVQFHPSGIYGSGCLITEGA
RGEGGFLVNSEGERFMERYAPTAKDLACRDVVSRAITMEIREGRGVGPEKDHMYLQLNHL
PASVLKERLPGISETAAIFAGVDVTKEPIPILPTVHYNMGGIPTKWTGEALTVDEEGNDQ
VIPGLMACGEAACVSVHGANRLGANSLLDLVVFGRAVAHTVADTLQPGLPHKPLPSDLGK
ESIANLDKLRNATGSKPTSQIRLAMQKAMQADVSVFRTQESLDEGVRNVGAIDESFEDVG
TTDRSMIWNSDMVETLELQNLLSNARQTAVSAANRKESRGAHAREDYPERDDKEWMKHTL
SWQKHPQGNVELGYRSVIATTLDESECPPVLPTVRAY
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgctttccgtcagacagatgaagctctccacgagcaggaggctgttcagccgcacgtcg
agggcgctgcgcgcgttcgcggccaacggcgacgtcgacggccagaacagcgcgcccttc
ggcggccagtatcaggtcgtcgaccacgagtacgactgcctggtggtcggcgccggcggc
gccggcctccgggccgcgttcgggctggccgaggccggctacaagaccgcgtgcatctcc
aaactgttccccacgcggtcgcacaccgtcgccgcgcagggcggcatcaacgccgccctg
ggcaacatgcacaaggacaactggaagtggcacatgtacgacaccgtcaagggctcggac
tggctgggcgaccaggactcaatccactacatgacgcgtgaggccgcggactcgatcatc
gagctcgagcacttcggcgtgcccttctccagaaccgaggagggccgcatctaccagcgt
gctttcggcggccagaccaaggaaaacggtaagggcggccaggcctacagaacctgcgcc
gtcgcggacagaaccggccacgcccttctgcacaccctgtacgggcaggcgctgagacac
aacacgcatttcttcatcgagtacttcgccttggacctcctggtccacaacggcgaggtg
gtcggtgtcattgcctacaaccaagaggacggcaccatccacaggttcagagcccacaag
accgtcatagccacgggtggctacgggcgggcctacttctcctgcacctccgcgcacacc
tgtaccggtgacggtaacgcgatggtgtccagagccggcttcccgctccaggacttggag
tttgtgcagttccatccatccggtatctacggctccgggtgtctgatcaccgagggtgcc
cgtggtgaaggtggcttcttggtcaactctgagggtgagagattcatggagcgttacgcc
cccaccgccaaggacttggcctgcagagacgtcgtgtcccgtgccatcacaatggaaatc
cgcgagggcagaggtgttggcccagagaaggaccacatgtacttgcaactaaaccacttg
cccgccagcgtcctgaaggagagactgccgggtatttctgagaccgctgctattttcgcc
ggcgtcgatgttactaaggagcctattccaattctacccactgtccactacaacatgggt
ggtatccccaccaagtggacaggtgaggctttgaccgttgacgaagaaggcaacgaccaa
gttatccctggcctgatggcgtgtggtgaggctgcctgtgtttccgttcacggtgccaac
agactgggtgccaactctctactggaccttgttgtctttggacgtgcagtcgctcatact
gttgccgacaccctgcagccaggtctaccacacaagccattgccatctgatctcggtaag
gaatccattgccaatcttgacaagctaagaaacgccactggctccaagccaacttctcag
ataaggctggccatgcagaaggctatgcaagcggacgtttcggtgttcagaacccaggag
tccctggacgaaggtgtaagaaacgtcggcgccattgacgagagcttcgaagacgtcggc
accaccgacagatccatgatctggaactcagacatggttgaaactttggagctacagaac
ctgttgtcgaatgcaagacagactgccgtttctgctgctaacagaaaggaatctcgtggt
gctcatgccagagaggactaccctgagagagacgacaaagagtggatgaagcacactctg
tcttggcaaaagcatccccaaggcaacgttgagctgggttacagaagtgtgatcgccact
acgctggacgagtctgagtgtcctccagttttgccaactgtgagagcttactga

DBGET integrated database retrieval system