KEGG   Lachancea thermotolerans: KLTH0G09262gHelp
Entry
KLTH0G09262g      CDS       T01117                                 

Definition
(RefSeq) KLTH0G09262p
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
lth  Lachancea thermotolerans
Pathway
lth00020  Citrate cycle (TCA cycle)
lth00310  Lysine degradation
lth00380  Tryptophan metabolism
lth01100  Metabolic pathways
lth01110  Biosynthesis of secondary metabolites
lth01130  Biosynthesis of antibiotics
lth01200  Carbon metabolism
Module
lth_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lth_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lth00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KLTH0G09262g
  09105 Amino acid metabolism
   00310 Lysine degradation
    KLTH0G09262g
   00380 Tryptophan metabolism
    KLTH0G09262g
Enzymes [BR:lth01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     KLTH0G09262g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N Imm52
Motif
Other DBs
NCBI-GeneID: 8293712
NCBI-ProteinID: XP_002555435
UniProt: C5DMI7
LinkDB All DBs
Position
G:767500..770541
Genome map
AA seq 1013 aa AA seqDB search
MLRGISRFSQQSVAKRALYRSGNQCVRGNWGTRCLATNSSDNFLSTTNAAYIDEMYEAWQ
KDPTSVHVSWNAYFKNMGNAGIPASSAFVAPPTLVSHHTGAQIPQDMVMGASGTMDQGIL
THLKVQLLCRAYQVRGHQKAHIDPLQISFGDDKSKPLPKELTLEHYGFTERDLDREITLG
PGILPRFTREGKKAMTLREIIAALEKLYCSSYGIEYIHIPSRAQCDWLRERIEIPQPYHY
TIDQKRQILDRLTWATSFETFLSTKFPNDKRFGLEGLEGVVPGIKTLIDKSVELGVEDVV
LGMAHRGRLNVLSNVVRKPNESIFSEFQGSAAPEEYEGSGDVKYHLGMNYQRPTTSGKYV
NLSLVANPSHLESQDPVVLGRTRAIMFAKNDLDKYQKAMGVLLHGDAAFAAQGVVYETMG
FSHLPDYSSGGTIHIITNNQIGFTTDPRFARSTPYPSDIAKAIDAPIFHVNANDVEALTF
IFNLAAEWRATFHTDAIIDVVGWRKHGHNETDQPSFTQPLMYQKISKQKSVIDVYTEKLI
SEGSFTKKDIDEHKQWVWGLFEKAFEKAKDYEPTSREWLTADWANFKSPKELATEILPHE
PTVVQQEKLKEIGKIISSWPEDFEVHRNLKRILTNRGKSIEKGEGIDWSTGEALALGSLA
TEGYHIRVSGEDVERGTFSQRHAVLHDQKSERTYTPLQHLSDKQANFTICNSSLSEYGCM
GFEYGYSLTSPDFLVMWEAQFGDFANTGQVIIDQFLAGGEAKWKQRSGLVLSLPHGYDGQ
GPEHSSGRLERFLQMANEDPRYFPSEEKLQRQHQDCNFQVVYPTTPANLFHILRRQQHRQ
FRKPLILFFSKQLLRHPLARSKLSDFSDNGFQWIIEDVEHGKSIASKEETKRLVIMSGQV
YTALHKKRESLGDKNTAFLKVEQLHPFPFAQLRDSLNSYPNLEDIVFCQEEPLNMGSWAY
AAPRLGTVLKETDKYKDFEVRFAGRNPSGAVAAGSKALHAAEEEAFLKEVFGQ
NT seq 3042 nt NT seq  +upstreamnt  +downstreamnt
atgttgagaggcatcagccgcttttctcaacaatcggtcgcaaaaagggcgctgtaccgt
agtggaaaccaatgtgtaaggggaaactggggcactaggtgcctggcgaccaacagcagc
gacaacttcctgtcgacaacaaatgcggcgtacatcgacgagatgtacgaggcgtggcag
aaggaccccacgtccgtgcacgtctcgtggaacgcgtatttcaagaacatgggcaacgcc
ggcatcccggcgtcgtccgcgttcgtggcgcctcccacgctagtgtcgcaccacaccggt
gcccagatcccacaagacatggtcatgggggcctcaggcaccatggatcagggcattctc
acacacttgaaggttcagctgctctgcagagcgtatcaagtgagaggccatcagaaagcc
cacatcgaccccctgcagatctcgttcggcgacgacaagtccaagcccttgcctaaagaa
ttgactctggagcactatgggttcacggaacgcgacttggaccgcgagatcacgttaggt
ccaggtattttgccccgcttcactcgagaaggcaagaaagccatgaccttgagggagatc
atcgcggcgctggagaagctgtactgttcttcttacggtatcgagtacattcacattcct
tctagagcccagtgtgactggctcagagagagaatcgagatccctcagccttaccactac
accatcgatcagaaaagacaaattttggatagactgacctgggcaacctcattcgagacc
tttctatccaccaaattcccaaacgacaagcgtttcggtctagaaggtctagagggtgtc
gtgccgggcatcaagacgctgatcgacaaatccgtagagctaggtgtcgaggacgttgtc
ctgggtatggctcaccgtggtagactgaatgtactgtctaacgtggtgcgtaaaccaaac
gaatctattttctcagagttccaaggctctgctgctcctgaggagtacgagggctcgggt
gacgtgaagtaccacttgggtatgaattaccagagacctaccacgtccgggaaatacgtc
aatttgtcgctggtcgctaacccatcgcacttggagtctcaagaccctgtcgtccttggt
agaacaagagctatcatgtttgccaagaatgacttagataaatatcagaaggccatgggt
gttttactgcatggtgacgcggctttcgccgcccaaggtgtcgtttatgaaactatggga
ttcagccatcttcccgattactcatctggtggtaccatccacatcatcacaaacaatcag
atcggtttcaccactgacccaagatttgcaagatctacgccatacccatctgatatcgct
aaagccatcgatgcaccaattttccacgtgaacgccaacgatgtggaagctctaactttc
attttcaacctagctgcagagtggagagccacattccacacagacgctatcatagatgta
gttgggtggagaaagcatggtcataatgaaactgatcaaccatctttcacccagccgcta
atgtaccagaagatcagcaaacagaagtccgtcattgacgtttacaccgagaagctaatt
tcggaaggctctttcaccaaaaaggacattgacgaacacaagcaatgggtttggggctta
tttgaaaaggctttcgagaaggcaaaggattacgaacctacatctagagaatggttgact
gccgactgggccaacttcaaatctccaaaggaacttgcgaccgagattttgccccacgaa
ccaactgtagtccagcaagaaaaactgaaagaaatcggaaaaatcatttcctcttggcca
gaagacttcgaggtccacagaaacttgaagagaattctgactaataggggtaagtcaatt
gagaaaggggaaggaattgactggtctacaggtgaagctttggcgctgggttctttggct
acggaaggctaccacatcagagtttccggtgaagacgtcgagagaggtactttttctcaa
agacacgcggttttgcatgatcaaaagtctgaaagaacctacactcccctgcagcacctg
agtgacaaacaagcaaactttactatttgtaactcttctctttccgaatacggatgcatg
ggtttcgagtatggttattcgcttacttctccagatttccttgtcatgtgggaagctcaa
tttggtgactttgctaacacgggacaggtcatcattgaccagtttttggcaggcggtgaa
gctaaatggaaacagcgttccggattggttctgtccttaccacacggttacgacggacaa
ggtccagaacactcttcaggtcgtctggaaagattcctgcaaatggctaacgaagaccct
agatatttcccttcggaagagaagctgcagagacagcaccaggactgcaatttccaagtt
gtctacccaaccacccctgctaacttgttccacatcttgagaagacaacaacatcgtcaa
ttccggaaacctttgattcttttcttctcgaaacagcttctgcgtcatcctttggctaga
tccaagctgtctgatttcagtgataatgggttccaatggatcattgaggatgttgagcat
ggcaagagtattgcctccaaggaagagaccaaacgcttggtcataatgagtggccaggta
tacactgctctccacaaaaagcgtgagtctctcggggacaagaatactgccttcctcaag
gttgaacagttacatccattcccattcgcacagctacgcgactcgctgaactcttatcca
aacttggaagacattgtgttctgccaggaggagccattaaacatgggctcctgggcctac
gcggcaccaaggttgggaaccgttctgaaagaaaccgacaaatacaaggatttcgaagtg
aggtttgctggtagaaacccaagcggagctgttgctgcgggctcaaaagctctacatgct
gcagaggaagaagcatttttgaaggaggtgtttggtcagtga

DBGET integrated database retrieval system