KEGG   Lachancea thermotolerans: KLTH0G12430gHelp
Entry
KLTH0G12430g      CDS       T01117                                 

Definition
(RefSeq) KLTH0G12430p
  KO
K13341  peroxin-7
Organism
lth  Lachancea thermotolerans
Pathway
lth04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:lth00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    KLTH0G12430g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: WD40
Motif
Other DBs
NCBI-GeneID: 8293855
NCBI-ProteinID: XP_002555573
UniProt: C5DMX5
LinkDB All DBs
Position
G:1057236..1058339
Genome map
AA seq 367 aa AA seqDB search
MLRYHTQGYSGYGVQYSPFFDNKVAVATGSNFGLVGNGKLFIIDIDNQGRMLETKSFVTQ
DGLFDVAWNELHENHVLVAQGDGSLRLFDIQLNDYPVAIFQEHEKEVFSCNWNLINKQLF
VSSSWDGTVKVWTPMRQSSLTTLTPKPMTAHNSALSSKDIPMSNQKRHTSLSKNKNCIYQ
SQFSPHDPNIVMSCAGNSYVTMFDLRQPANANQYSFMAHNGMETLTCDFNKYRSHIIATG
GVDNMVKVWDLRMVRKMAANSRQPMSVNEICGHDLAIRKVSWSPHHSNMLLSTSYDMTCR
VWQDLSDDGRRPTGKTNSIDPTHGCRFIFSHHTEFVFGADWSLWGQPGYVASTSWDGDVC
IWYAFAR
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgataccacacgcaaggctatagcggttacggtgtacagtactcaccttttttt
gacaataaagtagcggtggcaaccggctccaactttggtcttgtcggtaacggaaagttg
ttcattattgatatcgacaaccaaggcagaatgctcgaaacaaaatcgtttgtaactcag
gatgggctctttgatgttgcgtggaacgaactgcatgaaaaccatgtgctagtcgcgcaa
ggtgacggatccctcaggctcttcgacattcagctcaatgactatcctgtagccatcttt
caggagcatgagaaagaagtttttagttgcaactggaatctcattaacaagcagcttttt
gtaagcagttcatgggatggcaccgttaaagtttggaccccgatgaggcagtctagcttg
acgacccttacacctaaacccatgacggcgcataactcagcactgtcgtccaaggacatt
ccaatgtctaaccaaaaaaggcacacatccctatcaaagaacaaaaactgtatataccag
tcgcagttttcgcctcacgacccaaatattgtcatgagctgcgctggaaattcctacgta
actatgtttgatctgcggcagccagctaacgcaaatcagtacagtttcatggcccacaat
ggcatggagactttgacttgtgacttcaacaaatacagatcacatatcatcgcaactggt
ggcgttgataacatggttaaggtttgggatcttcgcatggtaagaaagatggcagcaaac
tcgagacaaccgatgagtgtgaacgaaatatgtggacatgacttggcaataagaaaagtt
tcttggtcacctcatcattctaacatgctgctttctacatcttatgatatgacatgcagg
gtgtggcaagatttgagcgatgacgggcgccgaccaactggtaaaacaaatagcattgac
cccacacacggttgtagattcatcttttcgcatcacacagaatttgttttcggagcggac
tggagtctttggggacaacctggatacgtcgcgtccacttcatgggatggcgatgtttgt
atatggtatgcttttgcaaggtaa

DBGET integrated database retrieval system