KEGG   Lachancea thermotolerans: KLTH0G12496gHelp
Entry
KLTH0G12496g      CDS       T01117                                 

Definition
(RefSeq) KLTH0G12496p
Organism
lth  Lachancea thermotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dopey_N
Motif
Other DBs
NCBI-GeneID: 8293858
NCBI-ProteinID: XP_002555576
UniProt: C5DMX8
LinkDB All DBs
Position
G:1060028..1065058
Genome map
AA seq 1676 aa AA seqDB search
MMSVPLKPLSVDFNSRQLDSKQKKFHASIERALQHFDSVTEWADYIASLGKLLKALQSWT
PQFQNVKYYVPFPYQVSRRLASSLSPNLPSGVHQKTIEVYNVIFSKIGIEALNKECNIWV
PGILPLMSYASISVKGPLIDLYENYLLRISPSALRLLVKPLVASLFPGIDDDSSEFQPAV
FSLLEVLRANVADEPLFWQSCFIVIITNKDRRLGGLAWLTRMLPSLNAVPHKVAQNKLEE
DKAKAKGDAKYRRQTALDLLLPEAKNVVHPEPGLLIRCLVNCLGEENELLIKRGVLDLLL
QRINLDSPVIQSLASDSDLRMLMMSCCKTMLNRDVSISRRIWNWLLGPASINANQQHQTN
ANEYFPHFGEQCLKEGLTAMMGDEAQAPVAFRICIAIMDRWEIASRIIPLVFVPLMKTVR
GFENNEIVMKNASSFFDSVETNIICSHLFQVTVFDLDLDLLSFVLSTFKVENDEEIVVRH
LPLLLMTVLAKRDEFALPDVYRVSALLVNLIPERAFLPIEHTGVLQDSRCNNQDVLKLIS
EYYTKLLSPATLSNVNDSYDLSPPFSSEDLTYLIVAEFHDVLLKTFNNEREFNKMVGLFV
KLMEKIPNDSNSTDDMSSVSAGKGLEQVLVNKLFEIKGELENHPNGSIFGWLKLYTDYLA
PKVTVIQSAKLTKTFVVGAWPYLIDPNTQIETVKSLDSLQGSVRGKHVESALAYAFISEL
GISSRISALEGIWVHSGDASTLARRPLELVLDELFDDQDPNFLSTSRWVLSVVKQGLAGR
LFHILCENILNCKLIYKGALEDLDDIDSYIYHCQTLINVLRIEPSIVLHTFNLEQTSVQT
LEIWNGADVSTYKNLAIAIAIKFLKTKNTTGKSVRTTLLLLDILLDGTEHNFKHIVIFLL
HLATKHFSSGDLESELISVSLLDIISKVLALSHNNQITLGIFEDDASHLRYIDFLVLGVT
SMDKPLIIHSYVKLLSESLVYFQNSIFSIILPLTTSITGCINKLFHSTSVKGDRYQSIAY
LIDGLQELMEVSHSYLAAEESGGYLSAGSSKNDFLQNMVANVFSNDSNASNSKLKHQREI
IVQSFKLVVSCCLNIWSWAHDYSKAREIEDHEPNEGLFEDSLHHQAYKYKYQSKKLLSAV
FGLEPLEVLEELISEGPSNVSLTLVHALDGNKPALTLPHLFQGIVYRCNKFSSITFSNTT
ASKSAPHPLLINQLETQPLLNFVLAYLSALESAALEEIFGDLMLFLKEITSNHQHYKQLA
PLVLKMIALVCEKLHNSRFGEDKRVRRELSDAFCRYLPNAVGEDVDINNATLYEDFDFVC
SRLKYIVIDYPSGDKFCTCVSLFVQFAVTPYFKKQNDRYIPRHVVRLALTTSKIGSKVKA
WKALVSEAFMSDKKFSLVGQSPLCAEVIFEWSNYPENREKLMQELIASIGTKANGISPNI
NPFTAWSDSEIETKCHNILRVSFLLLISPRDHHLLCFRSIMGQLEQNLISDDQRMKSHSF
LLLRCVLLQFSAMHFGEYWSMLAYSLQTGLQDFYEHLQMQQEFPADVVFQVSKCVDLILT
LNFEEFSACYEWLFVIDTMNCIYKSDPYISLADEISDFKDFTKSESDDFAMAQDPIVRVP
LLQGIHKVEKYTQLRGFFHNLSYAHYEEMYAMKKVDLDSCTSDALADVFALQLHQR
NT seq 5031 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcggtcccactcaagcctttgtcggtagactttaacagtcgacagctggactcg
aagcaaaagaagtttcatgcaagcattgagcgtgctctacagcattttgattcagtgacg
gagtgggcagattatattgccagtcttggaaaattactaaaagctctacaaagctggacc
ccccaatttcagaatgttaagtactacgtgccatttccatatcaagtgagtaggaggctc
gcgtcctctttatcccctaacttaccatctggtgttcatcagaaaacaattgaagtctac
aatgtgatattcagcaaaatcggaattgaagcgcttaataaagaatgcaacatttgggta
cctggcattttgccgttaatgtcctacgcgtcaatatcagttaagggccctcttatcgac
ctttatgagaactacttactgcgtatatccccttcagctcttcgacttctcgttaaacct
cttgttgccagtctattcccgggaattgatgacgatagcagtgaatttcagcccgctgtc
tttagccttttggaggttctacgcgcaaacgtagccgatgagcccttgttttggcaaagt
tgtttcatcgttataattacaaacaaagacaggaggttgggcggacttgcgtggctgact
cggatgcttccttctttgaatgctgttccacataaggttgctcagaacaaacttgaggag
gacaaagcaaaagcaaaaggcgatgccaaatataggcgtcaaactgcacttgatctcctt
ttgcctgaagctaaaaatgttgtgcatccagagccaggccttcttattcgttgccttgtg
aactgtttaggtgaagagaacgaactactcatcaaaaggggtgttttagaccttttactg
cagcgtatcaatttagattcgcctgtcattcaaagcttagcatcagactctgacctcaga
atgctcatgatgagttgctgtaagactatgcttaatcgtgatgtgtctataagccgaaga
atatggaattggcttttaggccccgcctctataaatgcaaatcaacaacatcaaacgaac
gcaaacgaatactttcctcattttggcgagcaatgccttaaggaaggtttgactgctatg
atgggagacgaggcacaggctccggtagcttttcgaatctgcatagccatcatggatcgc
tgggaaatcgcgtcacgaattattccacttgtttttgtgcctttgatgaaaacagttcgt
ggcttcgaaaacaacgaaattgtaatgaagaacgcgtcatccttttttgattctgttgag
acaaacattatatgcagtcatctttttcaagttactgtttttgaccttgacctcgatctt
ctttcttttgtcctgtcaacatttaaagttgagaacgatgaagaaatagtggtccgtcat
ttgccgctgttattaatgactgttttagcaaaaagggatgagttcgccttgcctgatgtt
tatcgtgtctcagctttgcttgtaaatctcattccagaaagagctttcttgcctatagag
cacactggtgtacttcaagacagtaggtgtaacaaccaagacgtgttgaaacttatctca
gagtactacactaagcttttgagcccggctactctctcgaacgtcaatgattcctatgat
ctatctcctccgttttcgagcgaagacttgacttatttgattgttgcggagttccacgac
gtgctattgaaaacattcaataacgaacgcgagtttaacaaaatggttggcctctttgta
aagctgatggaaaaaatccccaatgacagtaactcgactgatgatatgagctccgtttca
gctggaaaaggtcttgagcaggttttggtcaacaaactctttgagataaagggagagtta
gaaaatcatcctaatggatctatttttggatggctaaaactatatacagactacctcgct
ccgaaagttacggtcattcaatccgcaaagcttacgaagacatttgttgtaggtgcttgg
ccttacctgattgatcccaacactcaaatcgaaaccgttaagtcattagactctcttcaa
ggatctgtaaggggaaaacatgttgaaagcgctttggcatatgctttcatttcagaactt
ggcatatcatcaagaataagtgcattagaaggtatttgggtacattccggagatgcttca
actttagctcgaaggcctttagaattggttttggatgaattgtttgatgaccaagatcca
aattttctgagtacctcaagatgggtattaagtgtggtgaaacaaggtctggcgggtagg
cttttccatatcttgtgtgaaaatattctcaattgcaaattgatttacaaaggtgccttg
gaagatctcgatgatatcgattcatatatctatcattgtcaaacattgataaacgtgctt
aggattgaaccttctatcgtccttcatacgttcaatttggagcaaacatcagtgcaaacg
cttgagatttggaatggcgccgacgtttcaacttataaaaaccttgcaattgcaattgcg
atcaaatttttaaagactaaaaacactactggtaaaagtgttcgtacaactttgcttctt
ctcgatatcctgcttgatggtacagaacacaattttaagcacatcgtgatatttttactg
cacctcgcaactaaacattttagctcaggcgatttggaatctgagttgatctcggtttca
ttgcttgatatcatttcaaaggtattggccttgtcacacaataaccaaattacgctgggc
atcttcgaggacgatgcatctcatctaagatacattgatttccttgttctaggcgtaaca
agcatggataaacctcttattattcactcctatgttaagttgttatctgaaagtttggtt
tacttccaaaactcaatcttttccataatattgccactaacaacatccataactggttgc
ataaacaagttgtttcattcaacctctgtaaaaggagaccggtatcaatcaatagcgtat
ttgatcgatggattacaggaactgatggaagtctctcacagctacctcgcagcagaagaa
agcggagggtatttgagtgcaggatcttctaaaaacgactttttgcaaaacatggtagcc
aacgttttttcaaatgactctaatgcttcaaattccaaactcaagcaccagagagaaatc
attgttcaatctttcaagcttgtggtcagctgttgtctgaatatttggtcatgggcgcat
gattactcaaaagcgcgagagattgaagatcacgaaccgaatgaaggcctttttgaagat
tcattacatcaccaagcctataaatacaaataccaatccaagaagttattgagcgcggtt
ttcggcttggaaccattggaagtcctcgaggagctaatttcagagggtcctagtaatgtt
agtttaactttggttcatgctttggatggaaacaaaccggccttaacattgccacatttg
ttccagggcattgtctaccgctgtaacaagttctcgtcgataaccttctcgaacactaca
gcttcaaagagcgctccacatcccttacttataaaccaattagagacgcagccgctgcta
aactttgtcctagcttatctctcggcgcttgaaagcgcagcacttgaggaaatttttggt
gacttaatgttatttttgaaagaaatcaccagtaatcatcaacactacaaacaactggca
ccgttggttttgaagatgatagcccttgtttgcgaaaagttgcataattcaagatttggg
gaggacaaacgagtaagaagagagctttctgatgcattttgcaggtatttaccaaacgcg
gtgggggaggacgtggacatcaacaacgcaaccttatatgaagactttgactttgtctgt
tccaggttgaaatacattgtaattgactacccttcgggcgataagttctgtacttgtgtt
tcactgtttgttcaatttgcagttacgccttattttaagaagcagaatgataggtacatt
cccagacatgttgttcgcctcgctttgactacctcgaaaataggaagcaaagtcaaagca
tggaaagcccttgtcagtgaagccttcatgagcgacaagaaattttccctcgttgggcaa
agtccactttgtgctgaggttatttttgaatggtccaactatcctgaaaacagggaaaag
ctcatgcaagaattaatcgcatcgataggcacaaaagctaatggcatcagtcctaatatc
aacccctttactgcttggagtgattcggaaattgaaactaagtgccacaatattcttcgc
gttagctttctgctccttatatctcctcgtgatcaccacctgctctgctttaggtccatc
atgggtcagctagaacagaatttgatctcagatgatcaaagaatgaagtctcacagcttt
cttcttttgaggtgcgttctgctacagttttcagcaatgcacttcggcgaatactggagc
atgttggcttatagtttgcaaacaggccttcaagacttctatgagcatctacaaatgcaa
caagaatttccagcggatgtcgtttttcaagtctctaaatgtgttgacctgattttgact
ttgaacttcgaggagttttctgcttgctacgaatggcttttcgttattgatacaatgaac
tgcatttacaaaagtgatccttatatcagtctagcggatgagatcagcgacttcaaagac
ttcacaaaaagcgaatctgacgattttgcgatggcgcaagatcctatagtccgagttccc
ctactccaaggcattcacaaggttgagaagtacacccaactcaggggctttttccataat
ctaagctacgcgcattatgaggagatgtacgcgatgaagaaagtggacctggacagttgc
acgtcagatgctctggcggatgtgtttgctctgcaactacatcagcggtaa

DBGET integrated database retrieval system