KEGG   Lachancea thermotolerans: KLTH0G12518gHelp
Entry
KLTH0G12518g      CDS       T01117                                 

Definition
(RefSeq) KLTH0G12518p
  KO
K19589  release factor glutamine methyltransferase [EC:2.1.1.297]
Organism
lth  Lachancea thermotolerans
Brite
KEGG Orthology (KO) [BR:lth00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:lth03012]
    KLTH0G12518g
Enzymes [BR:lth01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.297  peptide chain release factor N5-glutamine methyltransferase
     KLTH0G12518g
Translation factors [BR:lth03012]
 Eukaryotic Type
  Release factors
   KLTH0G12518g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTS Methyltransf_23 PrmA Methyltransf_31 DUF938
Motif
Other DBs
NCBI-GeneID: 8293859
NCBI-ProteinID: XP_002555577
UniProt: C5DMX9
LinkDB All DBs
Position
G:complement(1065049..1065711)
Genome map
AA seq 220 aa AA seqDB search
MLPTPHVSCDYDKVYEPSEDSFLILDALEKEQAFLRTYFRSKPTVVCEVGCGSGIVTTFM
MQNDIPNEHAIYLPTDVNPWAMDSMVESASLNNCCTKMLSPIRTNLTSSIRPREIDFLVF
NPPYVPAESVPYMPLDSEANEGDWLDLALLGGDDGMAITWKLLDSLDKIMAPGGIAYILF
CARNHPEKVVKTMSTRGWKCELTEHRKAGWEVLSVYKFYR
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgcttccaacaccgcacgtcagctgtgactatgataaggtctacgaaccatcggaggat
agctttttaatactagatgctctagaaaaggaacaggcattcttgaggacttattttaga
tctaaaccgacggtcgtgtgcgaggtaggatgtgggtccggaatagtcacaacgttcatg
atgcaaaacgatattccaaacgagcacgctatatatcttcccacagatgtgaacccatgg
gcaatggactctatggtagaaagtgcttctctaaataattgctgcacaaaaatgctaagt
cctattcgcactaatctcaccagctctattcgcccaagagaaatagactttcttgtgttc
aaccccccatatgtccctgcggaatcagtgccgtatatgcctttagattcagaagccaat
gagggtgattggttagatctcgctcttctaggaggggacgatggcatggctatcacctgg
aagctcctcgacagccttgataaaattatggcgcctggaggcatagcatacattttgttt
tgcgcgaggaatcatcctgaaaaggttgttaaaacgatgtctactagaggctggaaatgt
gaactaacagaacacagaaaagctggctgggaggtgctgagcgtatacaagttttaccgc
tga

DBGET integrated database retrieval system