KEGG   Lachancea thermotolerans: KLTH0G12540gHelp
Entry
KLTH0G12540g      CDS       T01117                                 

Definition
(RefSeq) KLTH0G12540p
  KO
K12158  ubiquitin-like protein Nedd8
Organism
lth  Lachancea thermotolerans
Brite
KEGG Orthology (KO) [BR:lth00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:lth04121]
    KLTH0G12540g
Ubiquitin system [BR:lth04121]
 Ubiquitins and ubiquitin-like proteins
  Ubiquitin-like proteins (UBLs)
   KLTH0G12540g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ubiquitin Rad60-SLD Ubiquitin_2 TBK1_ULD TUG-UBL1
Motif
Other DBs
NCBI-GeneID: 8293860
NCBI-ProteinID: XP_002555578
UniProt: C5DMY0
LinkDB All DBs
Position
G:join(1065801..1065949,1066013..1066097)
Genome map
AA seq 77 aa AA seqDB search
MKLTVKTLTGKEIPVVVDPDDKVYRIKEYLEEKEGIPPTQQRLIFQGKQIDDDKSVSSAN
LSSGMQLHLVLTLRGGF
NT seq 234 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgacagttaagacattaaccggcaaagagataccggttgtggttgacccggat
gacaaggtttatcgcattaaagagtacttagaggagaaagaaggtattcctccaactcaa
cagagactaatttttcagggcaagcaaattgatgatgataaatctgtttcttctgccaac
ctaagttcgggaatgcaattgcatctcgttctaactctgcgcggcggtttttga

DBGET integrated database retrieval system