KEGG   Lachancea thermotolerans: KLTH0H01408gHelp
Entry
KLTH0H01408g      CDS       T01117                                 

Definition
(RefSeq) KLTH0H01408p
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
lth  Lachancea thermotolerans
Pathway
lth03030  DNA replication
lth03410  Base excision repair
lth03420  Nucleotide excision repair
lth03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:lth00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    KLTH0H01408g
   03410 Base excision repair
    KLTH0H01408g
   03420 Nucleotide excision repair
    KLTH0H01408g
   03430 Mismatch repair
    KLTH0H01408g
Enzymes [BR:lth01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     KLTH0H01408g
    6.5.1.6  DNA ligase (ATP or NAD+)
     KLTH0H01408g
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     KLTH0H01408g
DNA replication proteins [BR:lth03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    KLTH0H01408g
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     KLTH0H01408g
DNA repair and recombination proteins [BR:lth03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     KLTH0H01408g
   NER (nucleotide excision repair)
    Other NER factors
     KLTH0H01408g
   MMR (mismatch exicision repair)
    Other MMR factors
     KLTH0H01408g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 8294252
NCBI-ProteinID: XP_002555939
UniProt: C5E216
LinkDB All DBs
Position
H:complement(129752..131923)
Genome map
AA seq 723 aa AA seqDB search
MLRLVRAEMSSIKKQATLAKFFSSKKRSVEEEKSHEPAKKLHSDPIGAGSGSPSSSPPLA
TGSSDAGSVKVETSATSTGENTKAGTPTLPDSDEPAKRAVAATKGDPAKLGASAPKDSKI
LYAEMCNVFNEIEGTSSRLQIVKLCGDFLYSVLLKARKDIVPITYLLINKLGPDYQPGLE
LGLGEGLLMKTISESCGKSLQQIKARYRELGDLGRIAQEARAVQPTMFKPKPLTTGEVFS
NLQAIARSQGKDSQLRKVQLIKRMLTACQGLEAKFLIRSLESKLRIGLAEKSVLVALSKA
LLTYEHNGKEPSSELVDTAEQKIRDAFCQVPNYQIVIETALEHGIMELDKHCVLTPGIPL
KPMLAKPSKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGSMRIYSRNGENMTERYPE
IRISDFIADPARTHTLILDCEAVAWDKEKNTILPFQVLSTRKRKGVAVEDVKVRVCLFAF
DILCYNDEPLITRPLAERRACLERALVPVPGELQLASEVTTMSLDELQHYLDQAVRDCCE
GLMVKILEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYGRGKRTGTYGGFL
LGCYNQDSGEYETCCKIGTGFSEEMLQTLFDRLSPTAIPTPKAFYVHSESAPPDVWFEPT
LLFEVLTADLSLSPVYKAGTSSYGKGISLRFPRFIRLRDDKTPEEATSSEQVVEFYESQS
HVS
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgctaaggttggtacgcgcggaaatgtcgtctatcaaaaaacaagccactttggccaaa
ttctttagttccaagaagaggagtgttgaagaagaaaagtcgcatgaacctgccaaaaag
ctccattcagaccccattggggcaggttctggaagcccgagttcctccccacctcttgcg
acaggctccagtgatgctggctctgtgaaggttgagacatctgccaccagcacaggagaa
aacactaaggcaggaacaccaacgctcccagactcagatgagcctgccaagcgggccgtg
gccgccacaaaaggggaccccgcgaagcttggagcttcagctcctaaggacagcaagatt
ttgtacgctgagatgtgcaacgtgttcaacgagatagagggcacgtcgtcgagacttcaa
attgtaaagctttgtggtgacttcctgtactcggtgctgctcaaagcgcgtaaagacata
gttcccatcacttacctacttatcaacaagttaggtcccgactatcagccgggcctagag
ctggggctcggtgaaggcctgctcatgaagacaatcagtgagagttgcggcaagtcgctg
caacagattaaggcacgctatcgcgaacttggcgatctcggtcgcatagcgcaggaagct
cgggctgtacaacctacgatgttcaagcctaaaccactcactacaggagaggttttctca
aacttgcaggccattgcgcggtcgcaaggaaaagactcacaactgcggaaggttcagctt
atcaagagaatgctcactgcatgccaaggattagaggcaaaatttctcattagatcgctt
gaatcgaagctccgtattggccttgccgaaaaatctgtgctcgtggcgctttcgaaggcg
ctacttacgtatgaacacaacggcaaagaaccctcaagcgaacttgtggacactgcagaa
cagaagatccgcgatgcattctgccaagtgcccaactatcagatcgtgattgagacggct
ctagagcatggcattatggagctcgacaaacactgcgtactgacgccaggcatacctcta
aagccgatgcttgcaaagccgtcgaagtcgatttcagaggtcctggaccggttccagggc
cagcgcttcacctgcgagtacaagtatgatggcgagcgtgcgcaagtgcatctgctgcca
gacggcagtatgcggatctattcaagaaatggtgagaacatgacggagcggtaccccgaa
atccggatctctgactttattgcggatcccgcgcgcactcacacgctaatccttgattgc
gaggcagtcgcctgggacaaagagaagaacaccattctgccctttcaagtgctcagcacg
cggaagcgcaaaggcgtggcagtcgaagatgttaaggtgcgcgtgtgcctgttcgcattt
gacattctgtgctacaacgatgagcctcttatcacacgcccactagccgagcgccgcgcc
tgcctggagcgcgcgcttgtcccggtcccgggcgagcttcagctggctagcgaggtcacc
accatgagtctcgatgaacttcagcattatctcgaccaagccgtgcgcgactgttgcgaa
ggcctcatggtcaagatcctcgagggcgaagagtcccactacgagcccagcaagcgttcg
cgcaactggctgaaactcaagaaggactatttacagggcgtgggtgactctcttgacttg
tgcgttctgggcgcgtactacggccgtggcaagcgcacgggtacctacggtgggtttttg
cttggttgctacaaccaagattccggtgagtatgagacctgctgcaagattggcaccggt
ttttccgaggagatgctccagaccctgttcgaccgcctcagccctaccgcaattcctaca
cccaaggccttctacgtccacagcgagagcgctccacccgatgtttggtttgaacccacc
ctccttttcgaggtgctgaccgcagatctctcgctctcgcctgtttacaaggccgggacc
agctcgtacgggaaaggcatctctctccgcttccctcgtttcatccgcctcagagacgat
aagacacctgaagaagctacgtcttcagagcaggttgtggagttttacgaatcccagtcg
cacgtaagctga

DBGET integrated database retrieval system