KEGG   Leucobacter triazinivorans: EVS81_04645Help
Entry
EVS81_04645       CDS       T05843                                 

Definition
(GenBank) FAD-binding protein
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
ltr  Leucobacter triazinivorans
Pathway
ltr00020  Citrate cycle (TCA cycle)
ltr00190  Oxidative phosphorylation
ltr00650  Butanoate metabolism
ltr01100  Metabolic pathways
ltr01110  Biosynthesis of secondary metabolites
ltr01120  Microbial metabolism in diverse environments
ltr01130  Biosynthesis of antibiotics
ltr01200  Carbon metabolism
Module
ltr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ltr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ltr_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ltr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EVS81_04645
   00650 Butanoate metabolism
    EVS81_04645
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    EVS81_04645
Enzymes [BR:ltr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     EVS81_04645
    1.3.5.4  fumarate reductase (quinol)
     EVS81_04645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C FAD_binding_3 Pyr_redox_2 HI0933_like GIDA DAO Thi4 ThiF
Motif
Other DBs
NCBI-ProteinID: QBE48208
LinkDB All DBs
Position
1004128..1005894
Genome map
AA seq 588 aa AA seqDB search
MNTIAATTDTATRERLLSTSVLVIGTGGAGLRASIELAERGVQVLTVGKRRKHDAHTTLA
AGGINAALGTIDPEDSWQQHAADTLRESYFLGDPAIIEVVARNAARGIEDLERWGMPFAR
EADGRISQRFFGAHKYRRTCYAGDYTGLEIQRTLLRRARELDVPIVDTIYITRLLAADGR
IFGAYGFDIVDGTPVLIHADAVILAAGGHNRIWRNTSSRRDENTGDSFRLAALAGGRIRD
AELVQFHPSGILEPADAAGTLVSEAARGEGGILRNALGERYMERYDPERMELSTRDRVAL
ASYTEIVEGRGTTNGGVFLDVSHLPRETIFEKLPRVYRTLIDLQMLDITEQPIEIAPTAH
YSMGGVWVDAERHSTGVDGFYAIGEASSGLHGANRLGGNSLIELLVYGRITGADAAEYVS
GLTQVTRSTDAVGEARAEMRRLLSSTGTETPRLLQREVRNLMTEHAGVVRSEAGLREGLE
KLGAIEDRAGDLGVHPDIAGFDDLAHAFDLYGSLLAARATLECAVERRETRGCHNRSDFP
EQNDELRGSFVWTPEGGVTFERVAEAPDSFRDLARDAIDTSVEGKLVE
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccatcgcagcaaccaccgacaccgccactcgcgaacgcctgctctccacctcg
gtcctcgtcatcggcaccggaggcgcgggcctccgagcctccatcgagctcgccgagcgc
ggggtgcaggtgctcacggtcggcaagcgccgcaagcacgacgcccacaccacgctcgcc
gccggcggcatcaacgcggcgctcggcacgatcgatccagaggacagttggcagcagcac
gccgccgacacgctgcgcgagtcgtacttcctcggcgatcccgcgatcatcgaggtcgtc
gcccggaacgccgcccgcggaatcgaggatctcgagcgctggggcatgcccttcgcgcgc
gaggcggacgggcggatcagccagcgcttcttcggcgcccacaagtaccgccgcacctgc
tacgcgggcgactacaccggtctcgagatccagcgcaccctgctgcgccgcgctcgcgag
ctcgacgtgcccatcgtcgacaccatctacatcacccgactgctcgccgccgacggcagg
atcttcggcgcctacggcttcgacatcgtcgacggcacgccggtgctcatccacgccgac
gccgtgatcctcgcagccggcggccacaaccgcatctggcgcaacacctcctcacgccgc
gacgagaacaccggcgattcgttccgcctcgcggcgctggcgggcggcaggatccgcgac
gccgagctcgtccagttccacccgtcgggcatcctggagccggccgacgccgccggaacg
ctggtgtcggaggcggcgcgcggcgagggcgggatcctgcgcaacgcgctcggcgagcgg
tacatggagcgctacgatcccgagcgcatggagctctcgacccgagatcgcgtcgccctc
gccagctacaccgagatcgtcgagggtcgcggcaccacgaacggcggcgtgttcctcgac
gtctcccacctgccgcgcgagacgatcttcgagaagctcccccgggtgtaccgcacgctc
atcgatctgcagatgctcgacatcaccgagcagccgatcgagatcgctcccaccgctcac
tactccatgggcggcgtctgggtggacgccgagcgccacagcacgggcgtagacgggttc
tacgcgatcggcgaggcgtcctccggcctgcacggcgccaaccgcctcggcggcaactcc
ctcatcgagctgctggtgtacggccgcatcacgggcgccgacgccgccgagtacgtatcg
gggctgacgcaggtgacccgctcgaccgacgcggtcggcgaggcccgcgcagagatgcgc
cggctgctctcgagcacgggcacggagacgccgcgcctgctgcagcgcgaggtgcgcaac
ctcatgaccgagcacgcgggcgtggtgcgcagcgaggcgggcctgcgcgagggcctcgag
aagctcggagcgatcgaggatcgcgccggcgatctcggtgtgcacccggacatcgccggc
ttcgacgacctcgcccacgccttcgacctctacggctcgctgctggccgcgcgcgcgacg
ctggagtgcgccgtcgagcgccgcgagacccgcggctgccacaaccgctccgacttcccc
gagcagaacgacgagctgcgcggcagcttcgtgtggacgccagagggcggcgtgaccttc
gagcgggtggccgaggcgccggactcgttccgcgacctcgcccgagacgccatcgacacc
tcggtcgagggcaagctcgtggagtag

DBGET integrated database retrieval system