KEGG   Leucobacter triazinivorans: EVS81_15320Help
Entry
EVS81_15320       CDS       T05843                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ltr  Leucobacter triazinivorans
Pathway
ltr00473  D-Alanine metabolism
ltr00550  Peptidoglycan biosynthesis
ltr01100  Metabolic pathways
ltr01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ltr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    EVS81_15320
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EVS81_15320
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    EVS81_15320
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ltr01011]
    EVS81_15320
Enzymes [BR:ltr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     EVS81_15320
Peptidoglycan biosynthesis and degradation proteins [BR:ltr01011]
 Precursor biosynthesis
  Amino acid ligase
   EVS81_15320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATP-grasp_3 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: QBE50029
UniProt: A0A4V0Z1Y5
LinkDB All DBs
Position
3392137..3393249
Genome map
AA seq 370 aa AA seqDB search
MNTPAKRTVALLFGGRSSEHGISCVTAAGVLRAIDRARFDVVLVGITREGATVLMQEDDL
DEYRLEAGGLPEVLDNGTRVLWPASTATRALTLIDQSGSLRSLGHVDAVLPMLHGPYGED
GTVQGMLDLVDLPYVGSGVLGSALCMDKHAVKTVLADAGIAVAPWRTVTREQLARDPYLV
ERLDEGLRYPLFVKPARAGSSVGVSRVTEAAGLPAALDTAFAEDRTVLIESGVSGREVEI
AVLEGHGDEAPRTSSVIGEIVFTGRDFYDFDAKYLGAAGVELELPAKVTDEQYAAIRDAA
VLAFEVTQCAGLARIDFFLTADGPVLNEINTLPGFTPISMYPRLWEESGLGYTELITELV
ELAIAREPAY
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaacactcccgccaagcgcaccgtggccctcctgttcggcggccggtcgagcgagcac
ggcatcagctgcgtcaccgctgccggtgtgctccgcgcgatcgaccgcgccagattcgac
gtggtgctcgtcggcatcacccgcgagggtgcgaccgtgctcatgcaggaggacgacctc
gacgagtaccggctcgaagcaggcggcctgcccgaggtgctcgacaacgggacgcgggtg
ctgtggccggcctcgactgcgacgcgcgcgctgacgctgatcgatcagtccggatcgctg
cgcagcctcgggcatgtggacgccgtgctgccgatgctgcacggaccgtacggtgaggac
ggcaccgtgcaggggatgctcgatctcgtcgacctcccctacgtgggcagcggcgtgctc
ggatcggcgctgtgcatggacaagcacgccgtgaagaccgtgctggccgacgccggcatc
gccgtggcgccgtggcgcacggtgacccgcgagcagctggcgcgcgacccctacctcgtc
gagcgtctcgacgaggggctgcgctacccgctcttcgtgaagccggctcgcgccggctcc
tccgtcggcgtgagccgggtgacggaggcggcgggtctgccggccgccctcgacaccgcc
ttcgccgaagaccgcacggtgctgatcgagtcgggcgtgtcggggcgcgaggtggagatc
gccgtgctcgagggacacggcgacgaggctccgcgcaccagctcggtgatcggggagatc
gtgttcacggggcgcgacttctacgacttcgatgcgaagtacctcggcgcggccggggta
gagctcgaactgcccgcgaaggtcaccgacgagcagtacgccgcgatccgcgacgccgcc
gtgctggcgttcgaggtgacccagtgcgcggggctcgctcgcatcgacttcttcctcacg
gccgacggtcccgtgctgaacgagatcaacacgctgcccggcttcactccgatctcgatg
tatccgcggctctgggaggagtcggggctcggctacaccgagctcatcacggagctcgtc
gagctggcgatcgcgcgcgaacccgcgtactga

DBGET integrated database retrieval system