KEGG   Leucobacter triazinivorans: EVS81_15340Help
Entry
EVS81_15340       CDS       T05843                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
ltr  Leucobacter triazinivorans
Pathway
ltr00250  Alanine, aspartate and glutamate metabolism
ltr00280  Valine, leucine and isoleucine degradation
ltr00310  Lysine degradation
ltr00410  beta-Alanine metabolism
ltr00640  Propanoate metabolism
ltr00650  Butanoate metabolism
ltr01100  Metabolic pathways
ltr01120  Microbial metabolism in diverse environments
Module
ltr_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ltr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    EVS81_15340 (gabT)
   00650 Butanoate metabolism
    EVS81_15340 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    EVS81_15340 (gabT)
   00280 Valine, leucine and isoleucine degradation
    EVS81_15340 (gabT)
   00310 Lysine degradation
    EVS81_15340 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EVS81_15340 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ltr01007]
    EVS81_15340 (gabT)
Enzymes [BR:ltr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     EVS81_15340 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     EVS81_15340 (gabT)
    2.6.1.48  5-aminovalerate transaminase
     EVS81_15340 (gabT)
Amino acid related enzymes [BR:ltr01007]
 Aminotransferase (transaminase)
  Class III
   EVS81_15340 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: QBE50032
LinkDB All DBs
Position
3396656..3397993
Genome map
AA seq 445 aa AA seqDB search
MVDVIGGPSLPQERKLVTSIPGPKSQEMLARKNAAVAAGVGVALPVSIVAAGGGVMVDVD
GNSLIDLGSGIAVTGVGNSAPAVVAAVTEQVQQFTHTCFTVTPYDGYVRVAEKLNELTPG
DHEKRSALFNSGAEAVENAIKISRHYTKKNAVVVFDHAYHGRTNLTMGMTAKNIPYKDGF
GPFAPEVYRVPTSYPFRDGLSGAEAAQVALTQIEKQVGASNLAAIIIEPIQGEGGFIAPA
EGFLPALQEWATANGVVFILDEVQTGFARTGDLFAANHEGVVPDLVTTAKGIAGGLPLSA
VTGRAEIMDSAHAGGLGGTYAGSPIACAAALATIETYQQENLTERAREIGAIIEEFFGEL
AKSDDRIGDIRGRGAMQAIELVESGSQKPNAALTGAISKHAGEQGVILLTCGTYGNVIRF
LPPLAISDELLREGLQVVADALAAN
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggtcgatgtcatcggcggaccctcgctcccgcaggagcgcaagctcgtcaccagcatc
cccggccccaagtcgcaggagatgctggcgcgcaagaacgccgcggtcgccgcgggcgtc
ggcgtggcgcttcccgtctcgatcgtcgccgcgggcggtggcgtgatggtcgacgtcgac
ggcaactcgctgatcgacctcggctccggcatcgccgtgaccggcgtcggcaactcggct
ccggccgtcgtcgcggccgtgaccgagcaggtgcagcagttcacgcacacctgcttcacc
gtcaccccctacgacggctacgtgcgggtggcggagaagctcaacgagctcacccccggt
gatcacgagaagcgctcggcgctcttcaactccggtgccgaggccgtcgagaacgcgatc
aagatctcccgccactacaccaagaagaacgccgtcgtcgtcttcgatcacgcctaccac
ggccgcaccaacctcaccatggggatgacggcgaagaacatcccctacaaggacggcttc
ggccccttcgctcccgaggtctaccgcgtgcccacgtcgtacccgttccgcgacgggctc
agcggtgccgaggcggcccaggtggcactgacgcagatcgagaagcaggtcggcgcgtcg
aacctcgccgcgatcatcatcgagcccattcagggcgagggcggattcatcgctccggcc
gagggcttcctccccgcgctgcaggagtgggcgacggcgaacggcgtcgtcttcatcctc
gacgaggtgcagaccggcttcgcccgcaccggagacctcttcgccgcgaaccacgagggc
gtcgttccggatctggtgacgaccgccaagggcattgcgggcggcctgccgctctccgcg
gtcaccggtcgcgccgagatcatggactccgcccacgcgggcggcctgggcggcacctac
gccggcagcccgatcgcctgcgccgcggcgctcgccacgatcgagacctaccagcaggag
aacctcaccgagcgcgctcgcgagatcggcgccatcatcgaggagttcttcggcgagctg
gccaagagcgacgatcgcatcggcgacatccgcggccgcggtgcgatgcaggcgatcgag
ctcgtggagtccggctcccagaagccgaacgcggcgctcaccggcgcgatctcgaagcac
gcgggcgagcagggggtcatcctcctgacctgcggcacctacggcaacgtgatccgcttc
ctcccgccgctggcgatctccgacgagctgctgcgcgagggcctgcaggtcgtcgccgac
gccctggccgccaactga

DBGET integrated database retrieval system