KEGG   Lysobacter oculi: DCD74_01160Help
Entry
DCD74_01160       CDS       T05527                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
lue  Lysobacter oculi
Brite
KEGG Orthology (KO) [BR:lue00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DCD74_01160
Enzymes [BR:lue01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     DCD74_01160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like FAD_oxidored Glutaredoxin FAD_binding_2 K_oxygenase Thi4 DAO AlaDh_PNT_C NAD_binding_8 NAD_binding_9 FAD_binding_3 FMO-like DUF1223
Motif
Other DBs
NCBI-ProteinID: AXA83484
UniProt: A0A344J374
LinkDB All DBs
Position
complement(250588..252198)
Genome map
AA seq 536 aa AA seqDB search
MLDTELKAQLAAYLERLQAPLTLIATLDDGEASREMQDLLADITEAGAGRITLKNAAETG
VEPGSRLPSFRITRSDADTGVEFAGLPLGHEFTSLVLALLHVGGHPPKLDDDVITQIKSL
EGTNADSELRFETFFSQSCQSCPDVVQSLNTMAALNPRVRHIAVDGAAFAEEMQERGVMA
VPTVLLNGQPFGAGRMGFAEILAKLDTGAEEKAAKTINDKAPFDMLVVGGGPAGAAAAIY
SARKGIRTGVLAERFGGQVLDTLAIENFISVSHTEGPKMAAALEAHVGDYEVDVMNLQRA
EKLETVEGGFRLTTASGATVQAKSVVLSTGARWRKMNVPGEDQYMTKGVAFCPHCDGPLF
KGKRVAVIGGGNSGVEAAIDLAGIVGHVTLIEFDGKLRADEVLQAKLRSLPNVRIITSAL
TTEVLGDGAKVTGLVYEDRTTSEKHTVEMEGIFVQIGLLPNTEWLKDSGVALSPRGEIVV
DERGATSLPGVFAAGDATTVPYKQIIIAMGGGATASLSAFDHLIRSSVPAAQAKAA
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacaccgaactgaaagcccaactcgccgcctacctggagcgcctgcaggcgccg
ctgacgctgatcgccacgctggacgacggcgaggccagccgcgagatgcaggacctgctg
gccgacatcaccgaagccggcgcgggccgcatcacgctgaagaacgcggcggaaaccggc
gtcgaaccgggcagccgcctgccgagcttccgcatcacccgcagcgatgccgacaccggc
gtcgaattcgccggcctgccgctgggccacgagttcacttcgctggtgctggcgctgctg
catgtcggcggccatccgccgaagctcgacgacgacgtcatcacccagatcaagtcgctg
gaaggcaccaacgcggacagcgagctgcgcttcgaaaccttcttctcgcagtcgtgccag
agctgcccggacgtggtgcagtcgctcaacaccatggccgcgttgaacccgcgcgtgcgc
cacatcgcggtggatggcgcggcctttgccgaagagatgcaggaacgcggcgtgatggcc
gtgcccaccgtgctgctcaacggccagccgttcggcgccgggcgcatgggcttcgccgag
atcctcgccaagctcgataccggcgcggaggaaaaggcggcgaagacgatcaacgacaag
gcgccgttcgacatgctggtggtgggcggcggcccggccggtgcggcggcggcgatctac
tccgcgcgcaagggcatccgcaccggcgtgctggccgagcgtttcggcgggcaggtgctg
gacacgctggccatcgagaacttcatctcggtcagccacaccgaaggcccgaagatggcc
gccgcgctcgaagcccatgtcggcgattacgaggtcgatgtgatgaacctgcagcgcgcc
gagaagctggaaacggtcgaaggcggcttccgcctgaccacggccagcggcgcgaccgtg
caggccaagtccgtggtgctgtccaccggcgcgcgctggcgcaagatgaacgtgccgggc
gaggaccagtacatgaccaagggcgtggcgttctgcccgcattgcgacggcccgctgttc
aagggcaagcgcgtggcggtgatcggcggcggcaattccggcgtggaggcggcgatcgac
ctggccggcatcgtgggccatgtcaccctgatcgagttcgacggcaagctgcgcgccgac
gaggtgctgcaggccaagcttcgcagcctgcctaacgtccgcatcatcacctccgcgctc
accaccgaggtgctgggcgatggcgccaaggtcaccggcctggtctacgaggaccgcacc
accagcgagaagcacacggtcgagatggaaggcatcttcgtgcagatcggcctgctgccg
aacaccgagtggctgaaggacagcggcgtggcgctgagcccgcgcggcgagatcgtcgtc
gacgagcgcggcgcgaccagcctgcccggcgtgttcgccgccggtgacgcgaccaccgtg
ccctacaagcagatcatcatcgcgatgggcggcggcgcgacggcttcgctgtccgccttc
gaccacctgatccgcagctcggtgccggccgcgcaggccaaggcggcctga

DBGET integrated database retrieval system