KEGG   Luteimonas sp. 83-4: DCD74_03935Help
Entry
DCD74_03935       CDS       T05527                                 

Gene name
kynU
Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
lue  Luteimonas sp. 83-4
Pathway
lue00380  Tryptophan metabolism
lue01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lue00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    DCD74_03935 (kynU)
Enzymes [BR:lue01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     DCD74_03935 (kynU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 DegT_DnrJ_EryC1 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AXA83954
UniProt: A0A344J4J4
LinkDB All DBs
Position
complement(818984..820261)
Genome map
AA seq 425 aa AA seqDB search
MSDDIFNIAYARARDAACPLRGFRDEFLIPMHEGHEQAYFAGNSLGLQPKGARAHVEEVL
DKWATEAVEGHFTGQAQWMPYHELVREPLAAIVGAQPHEVVAMNSLTANLHLMMVSFYQP
TIERTAILIEAGSFPSDRYAVESQLKYRGLPPHLTLIEVEPDLPHSVFSMEAIERAIREN
GPRLAMILWSGVQYRTGQAFDLKEIARLGHEAGAIVGFDLAHGVGNLELKLHDSGADFAV
WCHYKYMNSGPGAVAGCFVHERHARTERPRFAGWWGNSQDVRFRMGPEFNPTPGADGWQL
SNPPILGLAPLRASVEQFQRAGMTALRDKSRGLTGYLEQLIDTRLSDAIESITPRDDTQR
GAQLSLRVKAGRDAGRALFAHLQSRGVLGDWREPDVIRISPAPLYNNHEDVLRFAQAARE
WIDAH
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgacatcttcaacatcgcctacgcccgcgcacgggatgccgcctgcccgctg
cgtggtttccgcgacgagttcctgatcccgatgcacgaaggccacgaacaggcctacttc
gccggcaattcactgggcctgcagccgaagggcgcccgcgcgcatgtcgaggaagtgctg
gacaagtgggcgaccgaagccgtcgaaggccatttcaccggccaggcgcagtggatgccg
taccacgagctggtgcgcgaaccgctcgccgccatcgtcggtgcgcagccgcatgaagtg
gtggcgatgaattcgctgaccgccaacctgcatctgatgatggtcagcttctaccagccg
accatcgagcgcaccgcgatcctgatcgaagccggcagctttccgtccgaccgttacgcg
gtggagtcgcagctgaagtatcgcgggctgccgccgcatctcaccctgatcgaagtcgaa
cccgacctgccgcatagcgtgttctcgatggaagcgatcgaacgcgcgatccgcgagaac
ggcccgcgcctcgccatgatcctgtggtccggcgtgcagtaccgcaccgggcaggcgttc
gatctgaaggagatcgcccgcctcggccatgaagcaggcgccatcgtcggtttcgacctg
gcgcatggcgtcggcaatctggaattgaagttgcacgacagcggcgcggacttcgcggtc
tggtgccactacaagtacatgaactcggggccgggcgcggtcgccggttgcttcgtgcac
gagcgtcacgcacgcaccgaacgcccgcgcttcgcaggctggtggggcaacagccaggat
gtgcgtttccgcatggggccggagttcaacccgacgcccggcgccgatggctggcagctg
tcgaacccgccgatcctcggcctcgcgcccctgcgtgcgtccgtcgagcagttccagcgt
gcgggcatgaccgcattgcgcgacaagtcccgcggccttaccggctatctggaacaactc
atcgacacacggttgagcgacgccatcgaaagcatcaccccgcgcgacgacacgcaacgc
ggcgcgcaactgtcgctgcgggtcaaggccggacgcgatgccggacgcgccctcttcgcc
cacctgcaatcacgcggcgtgctcggtgattggcgcgaaccggacgtgatccgcatctcg
cccgccccgctctacaacaaccacgaggacgtgctgcgtttcgcgcaggcggccagggaa
tggatcgatgcccattga

DBGET integrated database retrieval system