KEGG   Luteimonas sp. 83-4: DCD74_05570Help
Entry
DCD74_05570       CDS       T05527                                 

Definition
(GenBank) bifunctional 23S rRNA (guanine(2069)-N(7))-methyltransferase RlmK/23S rRNA (guanine(2445)-N(2))-methyltransferase RlmL
  KO
K12297  23S rRNA (guanine2445-N2)-methyltransferase / 23S rRNA (guanine2069-N7)-methyltransferase [EC:2.1.1.173 2.1.1.264]
Organism
lue  Luteimonas sp. 83-4
Brite
KEGG Orthology (KO) [BR:lue00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:lue03009]
    DCD74_05570
Enzymes [BR:lue01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.173  23S rRNA (guanine2445-N2)-methyltransferase
     DCD74_05570
    2.1.1.264  23S rRNA (guanine2069-N7)-methyltransferase
     DCD74_05570
Ribosome biogenesis [BR:lue03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    DCD74_05570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0020 Methyltrans_SAM THUMP Cons_hypoth95 MTS Methyltransf_25 Methyltransf_31
Motif
Other DBs
NCBI-ProteinID: AXA84234
UniProt: A0A344J5C4
LinkDB All DBs
Position
complement(1157046..1159178)
Genome map
AA seq 710 aa AA seqDB search
MKFFASCGKGLEYLLADELLALGCAKATATMAGVNVEGEAIDAQRAVLWSRFASRVLWPL
TEFDCPDEAALYAGARAIDWTAHLDAGMTLAVDAHVSGEGITHARFAAQRVKDAVVDALR
EATGARPSVDAESPDLRINLVVRKGRAIVSIDLSGGPMHRRGWRAMQGEAPLKENVAAAV
LARGGWPRRYHDGGALLDPMCGSGTLLVEGALMAADVAPGLQRHGLRLPTYWKGFDRDGW
HALHTEAEARAKAGIAALRPAFFGRDLDSRAIDAARRNAENAGVASAIVFDVREMAHLTA
PPADSGLVACNPPYDARLAADAALYRQLGDVLKTAVPGWSASLLCGDDELARATGLFARK
RYQIFNGAIECTLIVVDPLAPPERVDVAPRPLSEGAQMVANRIDKNLRKLKSWCKREGIE
CFRAYDADLPEYAAAIDVYREADNGETWLHVQEYAAPSSIPEALAERRLGDLLAAARRAF
DVPKERVAIKTRATGKGGSKYGRFARTGEFLTVREGPSRLKVNLFDYLDTGLFLDHRPLR
MRMAKEAQGRRFLNLFCYTGVASVQAAMGGAAQTTSIDLSATYLDWLADNLRENGQGGSR
HRIAQADAMEWLESERGDFDIIFCDPPTFSNSKRADDFDVQRDHVRLLRAAVARLAPEGV
LYFSNNFRRFKLDEAAVGEFAQVEDISASTIPLDFARNPRIHRAWRIIRR
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcttcgcaagctgcggcaagggcctcgaatacctgctcgccgacgagctgctc
gcgctcggctgcgccaaggcgaccgccaccatggcgggcgtgaatgtcgaaggcgaggcc
atcgacgcacaacgcgccgtgttgtggtcgcgcttcgccagccgcgtgctgtggccgctc
accgagttcgactgccccgacgaagccgcgctctacgccggcgcccgcgccatcgactgg
accgcccacctcgacgccggcatgacgctcgccgtcgacgcgcatgtctccggcgaaggc
atcacccacgcgcgtttcgccgcgcaacgggtcaaggatgcggtggtcgatgcgttgcgc
gaggcgaccggcgcgcggccttcggtggatgccgaatcgcccgacctgcgcatcaacctg
gtcgtgcgcaagggccgcgcgatcgtgtcgatcgatctctcaggcgggccgatgcaccgt
cgcggctggcgcgcaatgcagggcgaggcgccgttgaaggaaaacgtggcggcggccgtg
ctcgcacgcggcggctggcccaggcgctaccacgacggcggcgccctgctcgacccgatg
tgcggcagcggcacgctgctggtcgaaggcgcgttgatggcggccgatgtcgccccgggc
ctgcagcgccacggcctgcgcctgccgacctactggaagggtttcgaccgcgacggctgg
catgcgctccacaccgaagccgaggcgcgggccaaggccggcatcgccgcgttgcgtccc
gcgttcttcgggcgcgacctcgattcgcgtgccattgatgccgcccgccgcaacgcggaa
aacgcgggcgtcgcatcggccatcgtcttcgacgtgcgcgagatggcgcacctgaccgca
ccgccggccgacagcggcctggtcgcctgcaatccaccttacgacgcccgcctggccgcc
gatgccgcgctctaccggcagttgggcgatgtgctgaaaaccgcggtgcccggctggagc
gccagcttgctttgcggcgacgacgaactggcgcgggccaccggcctgttcgcgcgcaag
cgctaccagatcttcaacggcgcgatcgaatgcacgttgatcgtggtcgatccgctggcg
ccgccggaacgcgtggatgtcgcgccgcgcccgctgtcggagggcgcgcagatggtcgcc
aaccgcatcgacaagaacctacgcaagctcaagagctggtgcaagcgcgagggcatcgaa
tgcttccgcgcctacgacgccgacctgccggaatacgccgctgccatcgatgtctatcgc
gaagcggacaacggagagacctggctgcacgtgcaggaatacgcagcgccgagttccatc
cccgaagcgctggccgaacgccgcctgggcgatctgctggccgccgcgcgccgcgccttc
gacgtgccgaaggaacgcgtcgccatcaagacccgcgccaccggcaagggcggcagcaag
tacggccgcttcgcgcggaccggcgagttcctgaccgtgcgcgagggcccgtcgcggctc
aaggtcaacctgttcgattacctcgacaccggcctgttcctcgaccatcgccccttgcgc
atgcgcatggcgaaagaggcgcagggcaggcgcttcctcaacctgttctgctacaccggc
gtggccagcgtgcaggcggcgatgggcggcgcggcgcagaccaccagcatcgacctctcg
gcgacctacctcgactggctcgccgacaacctgcgcgagaacgggcagggcggcagccgc
caccgcatcgcccaggcggacgcgatggaatggctggagtccgagcgcggcgatttcgac
atcatcttctgcgacccgccgaccttctccaattcaaagcgggcggatgatttcgatgtg
cagcgcgaccacgtgcgcctgctgcgcgcggcggtggcgcggctggccccggagggcgtg
ctgtatttctccaacaacttccgccgtttcaagctggatgaggcggcggtgggtgaattc
gcgcaggtcgaggacatcagcgcctcgaccattccgctggatttcgcccgcaacccgcgg
atccaccgcgcgtggcggatcatccgccgctag

DBGET integrated database retrieval system