KEGG   Urechidicola croceus: LPB138_04595
Entry
LPB138_04595      CDS       T04497                                 

Definition
(GenBank) secondary thiamine-phosphate synthase
Organism
lul  Urechidicola croceus
SSDB
Motif
Pfam: UPF0047
Other DBs
NCBI-ProteinID: AOW20005
UniProt: A0A1D8P613
LinkDB
Position
complement(989360..989782)
AA seq 140 aa
MKFFQKEIRLPAYSRGFHLVTSQILSQFTELQEIEVGQLQVFIKHTSASLTINENADPTV
RQDFESHFNKMVPENMPYYIHTYEGSDDMPAHIKASLLSTSVQIPISKGKLNLGTWQGIY
LCEHRNYGGSRKLVLTAFGS
NT seq 423 nt   +upstreamnt  +downstreamnt
atgaaattttttcaaaaagaaataaggttaccagcttatagtcgaggttttcatttggtg
actagtcaaatattatctcaatttacagaactccaagaaattgaggttggacaattacaa
gtatttattaaacatacttctgcaagtttaactataaacgaaaatgctgatccaaccgtt
cgtcaggattttgaaagccattttaataaaatggtacctgaaaatatgccatattatatt
catacctatgaggggtctgatgatatgcctgcacacatcaaagcctcattacttagtact
tctgttcaaatacccatatctaaaggaaagttaaatcttggtacatggcaaggaatttat
ttatgcgaacatagaaattatggagggagccgaaaattagtattgacggcttttggaagt
tga

DBGET integrated database retrieval system