KEGG   Urechidicola croceus: LPB138_04610
Entry
LPB138_04610      CDS       T04497                                 

Definition
(GenBank) peptidase M48
Organism
lul  Urechidicola croceus
SSDB
Motif
Pfam: Peptidase_M48 Peptidase_M13
Other DBs
NCBI-ProteinID: AOW20008
UniProt: A0A1D8P5Z6
LinkDB
Position
complement(992349..993206)
AA seq 285 aa
MKKVTSLLVVFLFLLSCSTVPITGRKRINLVSDAQILPASFAQYEGFLKENKLSSDIKNT
RSIQDVGMKISRAVDRFMRANNMISEANNYRWEFNLIEDENVNAWCMPGGKVVFYTGILP
ICANTDGVAAVMGHEVAHAFAKHGQERMSQGYLQQAGGLAVAIGTANKNPQAREIWNTAF
GLGSQLGMLAFSRTHETEADRLGLVFMIMAGYKPEEAVNVWIRMSQRASASEAPPEFLST
HPSNQTRIKNLKDYMPTAIAYAKKFNEQAAIQQEQQQQLKNQARQ
NT seq 858 nt   +upstreamnt  +downstreamnt
atgaaaaaagtaacctcactacttgttgtttttctattcttactaagttgtagtacagta
cctattactggtagaaaaagaataaatttagtcagtgatgctcaaatattgcctgcgagt
tttgctcaatatgaagggtttttgaaggaaaataaactatcaagtgatataaaaaataca
cgatcaatacaagatgttggtatgaagatatctagagctgtagatagatttatgagggca
aataatatgatatctgaagcaaataattaccgctgggaatttaatttaatagaagatgaa
aatgtaaatgcttggtgcatgccaggaggaaaagttgttttttatacaggaattttaccg
atttgtgcaaatactgacggagtagcagcagttatgggacatgaggttgctcatgcattt
gcaaaacatggtcaagagcgtatgtctcaaggatatttgcaacaagcaggaggattggca
gttgcaattggaactgcaaataaaaatccacaagcacgagaaatatggaatacagcattt
ggcttgggatctcaattggggatgttagcattcagtagaacacatgaaacagaggctgat
aggttaggacttgtttttatgataatggcaggatataagcctgaagaagctgtaaatgtt
tggattagaatgagtcaacgtgcaagtgcatcagaagcaccaccagaatttttaagtaca
catccatcaaatcaaacaagaattaaaaatttaaaagattatatgccaacagcaatcgcc
tatgctaaaaagtttaatgaacaagctgcaatacagcaagagcagcaacaacagttaaaa
aatcaagcaagacaataa

DBGET integrated database retrieval system