KEGG   Lutibacter sp. LPB0138: LPB138_05660Help
Entry
LPB138_05660      CDS       T04497                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
lul  Lutibacter sp. LPB0138
Brite
Translation factors [BR:lul03012]
 Eukaryotic Type
  Elongation factors
   LPB138_05660
 Prokaryotic Type
   LPB138_05660
Mitochondrial biogenesis [BR:lul03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    LPB138_05660
Exosome [BR:lul04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   LPB138_05660
  Exosomal proteins of breast cancer cells
   LPB138_05660
  Exosomal proteins of colorectal cancer cells
   LPB138_05660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW AAA_29
Motif
Other DBs
NCBI-ProteinID: AOW20197
UniProt: A0A1D8P6N2
LinkDB All DBs
Position
complement(1245279..1246463)
Genome map
AA seq 394 aa AA seqDB search
MAKETFDRSKPHLNIGTIGHVDHGKTTLTAAITTVLASKGLSELRDFSSIDNAPEEKERG
ITINTSHVEYQTANRHYAHVDCPGHADYVKNMVTGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGIPRMVVFMNKVDMVDDEELLELVDMEIRDLLSFYEYDGDNTPVIAGSALGGLN
GDAKWVDSIMELMDAVDSWIELPQRDVDKDFLMPIEDVFTITGRGTVATGRIESGVANTG
DGVDIIGMGAEKLTSTITGVEMFRKILDRGEAGDNVGILLRGIEKSQIKRGMVICKPGSV
TPHAKFKAEVYVLKKEEGGRHTPFHNNYRPQFYVRTTDVTGTINLPDGVEMVMPGDNLTI
TVELHQPIAMNVGLRFAIREGGRTVGAGQVTEIL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagaaacctttgaccgttcaaaaccacacttaaacattggtactattggacac
gttgaccacggtaaaacaactttaacagctgcaattactacagtattagcatctaaaggt
ctttcagaattaagagacttttcttcaattgataatgctcctgaagaaaaagaaagaggt
attacaattaatacttctcacgttgaatatcaaacggcaaatcgtcactacgcacacgtt
gactgtccaggtcacgcggattacgtgaagaacatggtaactggtgctgctcaaatggat
ggtgcaattttagttgttgctgctactgatggaccaatgccacaaacacgtgagcacatc
ttattaggtcgtcaagtaggtattcctagaatggttgtattcatgaataaagtggatatg
gttgatgatgaggagttattagaattagttgatatggaaatcagagatttgctatctttc
tatgagtatgacggagataacactcctgttattgctggatctgctttaggtggattgaat
ggagatgcaaagtgggttgattcaattatggaattgatggatgctgttgattcatggatt
gaattaccacaacgtgatgtagataaagatttcttaatgccaattgaagatgtatttaca
attacaggtcgtggaactgttgctactggtcgtatagagtctggtgtagctaatacaggt
gatggtgttgatatcataggtatgggagctgaaaagttaacatctacaattactggagtt
gaaatgttccgtaaaattttagatagaggtgaggctggagataatgtaggtatcttatta
agaggtattgaaaaatctcaaattaaaagaggtatggtaatctgtaagccaggttctgta
actccacatgctaaatttaaagctgaagtatacgtacttaagaaagaagaaggtggtcgt
cacactccattccataataactatcgtccacagttctacgttagaactacagatgtaaca
ggtacaattaacttacctgatggagttgaaatggtaatgccaggtgataacttaacaatt
actgttgaattacatcaaccaattgcaatgaacgtaggattacgttttgcaatccgtgaa
ggtggtagaacagtaggtgctggtcaggttacagaaattctttaa

DBGET integrated database retrieval system