KEGG   Lutibacter sp. LPB0138: LPB138_10255Help
Entry
LPB138_10255      CDS       T04497                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
lul  Lutibacter sp. LPB0138
Pathway
lul00010  Glycolysis / Gluconeogenesis
lul00053  Ascorbate and aldarate metabolism
lul00071  Fatty acid degradation
lul00280  Valine, leucine and isoleucine degradation
lul00310  Lysine degradation
lul00330  Arginine and proline metabolism
lul00340  Histidine metabolism
lul00380  Tryptophan metabolism
lul00410  beta-Alanine metabolism
lul00561  Glycerolipid metabolism
lul00620  Pyruvate metabolism
lul00625  Chloroalkane and chloroalkene degradation
lul01100  Metabolic pathways
lul01110  Biosynthesis of secondary metabolites
lul01120  Microbial metabolism in diverse environments
lul01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lul00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LPB138_10255
   00053 Ascorbate and aldarate metabolism
    LPB138_10255
   00620 Pyruvate metabolism
    LPB138_10255
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LPB138_10255
   00561 Glycerolipid metabolism
    LPB138_10255
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LPB138_10255
   00310 Lysine degradation
    LPB138_10255
   00330 Arginine and proline metabolism
    LPB138_10255
   00340 Histidine metabolism
    LPB138_10255
   00380 Tryptophan metabolism
    LPB138_10255
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LPB138_10255
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    LPB138_10255
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LPB138_10255
Enzymes [BR:lul01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     LPB138_10255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AOW21038
UniProt: A0A1D8P8X6
LinkDB All DBs
Position
2279300..2280835
Genome map
AA seq 511 aa AA seqDB search
MTNIYESLKKLGLKDLNDGTSTGSNNFSNGEIIESYSPVDGKLIGKVKTTTKTDYNKVMD
AATSAFKSWRDVPAPQRGEIVRQFGNKLRDLKQPLGELVSYEMGKSLQEGLGEVQEMIDI
CDFAVGLSRQLNGQTIPSERPGHVMREQWHPIGVVGIISAFNFPVAVWAWNTALAWICGD
VCVWKPSEKAPLCSVACQNIIASILKENNLPEGISCIINGDYKVGEFMTTDTRIPLISAT
GSTRMGRIVGTTVAKRFGKSLLELGGNNAIIITPTADLKVVVPGAVFGAIGTCGQRCTST
RRLIIHESVYDKVRDAIVGAYSQLTIGNPLDEKNHIGPLIDKDSVNTYLAAIEKAKAEGG
KVLVEGGVLEGKGYESGCYVKPAIIEAENHFEIVQHETFAPILYLMKYSGEVENAIEKQN
GVAQGLSSAIMTNSMKEAEKFLSYAGSDCGIANVNIGTSGAEIGGAFGGEKETGGGRESG
SDAWKVYMRRQTNTINYSDELPLAQGIKFDL
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgaccaatatatacgaatctttaaaaaaactaggcttaaaagacctcaatgatggtact
tctacaggttcaaataatttttctaacggagaaattatagaatcatactcaccagttgat
ggaaaactaattggaaaagtaaaaacgacaactaaaacagactataataaagtaatggat
gccgcaacaagtgcttttaaatcttggagagatgtaccagcacctcaacgtggagaaatt
gtacgtcagtttggaaataaattaagagatttaaaacaaccccttggcgaattagtttct
tatgaaatggggaaatctttacaagaaggacttggggaagtacaagaaatgattgatatc
tgtgattttgctgttgggttatcaagacaattaaacggtcaaacaatcccttcagaacgt
ccaggacacgtcatgagagaacaatggcatccaataggcgttgttgggattatttctgct
tttaattttccagttgcagtttgggcttggaatactgctttggcttggatttgtggtgat
gtatgcgtatggaaaccttctgaaaaagcgcctttatgctcagtagcatgccaaaacatt
attgcatcaattttaaaagaaaataatttaccagaaggcatttcttgtattatcaatggt
gattataaagttggtgaattcatgactacagatacaagaattcctttaatatcagcaact
ggttctacaagaatgggaagaatcgttggcacaactgttgcaaaacgttttgggaaatct
ttattagaacttggaggtaacaatgccataattattacaccgactgccgatttaaaagtc
gtggttccaggtgccgtctttggtgctattggtacatgcggacaacgttgtacttctact
cgtagattaattattcatgagtcagtttatgataaagtaagagatgcaatagttggtgct
tatagtcaactgacaattggtaatcctttagatgaaaagaatcatattggtcctttaatt
gataaggattctgtaaatacatatttggctgctattgaaaaagcaaaagccgaaggtggt
aaggttttagttgaagggggagttcttgaaggaaaaggatacgaaagtggttgttatgta
aaacccgcaattattgaagcagaaaaccattttgaaattgtgcaacatgaaacttttgct
ccaattttatatttaatgaaatattctggagaagtagaaaatgcgatagaaaaacaaaat
ggagttgcacaaggattgtcttctgcaattatgacaaattctatgaaagaagctgaaaaa
ttcttgtcttatgcaggttcagattgtggtattgctaatgtaaacattggtacttctggt
gcagaaattggtggtgcttttggtggtgaaaaagaaactggaggagggagagagtctgga
tctgatgcttggaaagtatacatgagaagacaaacaaatactataaactattctgacgaa
ttacctttggctcaaggaataaagtttgatttgtag

DBGET integrated database retrieval system