KEGG   Lutibacter sp. LPB0138: LPB138_10455Help
Entry
LPB138_10455      CDS       T04497                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
lul  Lutibacter sp. LPB0138
Pathway
lul00564  Glycerophospholipid metabolism
lul01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lul00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    LPB138_10455
Enzymes [BR:lul01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     LPB138_10455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 Pyr_redox_2 FAD_oxidored FAD_binding_3 NAD_binding_8 GMC_oxred_N GIDA 3HCDH_N YkyA HI0933_like Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AOW21074
UniProt: A0A1D8P931
LinkDB All DBs
Position
2328460..2330094
Genome map
AA seq 544 aa AA seqDB search
MNNRQESIKKLTSEEFDLLIIGGGITGAGIALDASSRGMKVALVEKNDFASGTSSKSTKL
IHGGLRYLKQFDFWLVKEVGSERAIVHKLAPHLVIPEKMILPLIKNGTYGSWLTSIGLKI
YDILASVEGDDKRKMLDKKEALKIEPLLPEKILEGAGYYAEYRTDDARLTLEVIKTALNY
NAVALNYCKANEFIYEEEKVRGVEVEDLIANKKFKIKAKYVVNATGPWVDTVRQINHSKI
GKRLHLTKGVHLVIAHEKLPINQAVYFDVPDGRMMFAIPRGKITYIGTTDTNYQEDKDNV
AVSAVDAVYLISAVNNMFPTINLTLDDIQSSWAGLRPLIHEEGKSASELSRKDEIFVSET
ELISIAGGKLTGYRKMAERIVDIVAKKYKKRYEKKYKSIKTEKITLTGGDFKNYKKVIKY
QESVFEQLKSDGFSQKDVNYLVHNYGTQTDEILKKYQEIKSDNAQISLAKAELWFSLNYE
MAQTPSDFFIRRTGRLYFDIESIKILKTAILNEFKSFFNWDDKTLKKHELKLDQAVHEAT
NFTH
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgaataatagacaggaaagtattaaaaaattaacctctgaagaatttgatttgctaatt
ataggtggcggaattactggagcaggaatagcgttggatgcttcatcaagaggaatgaaa
gttgccttggttgaaaaaaatgattttgcctcaggtacaagtagtaaatcaaccaaatta
attcatggtggattgcgttatttaaagcaatttgatttttggttggttaaagaagttggc
tctgaaagagcgattgttcataaactggcccctcatcttgtaattccagaaaaaatgatt
ttaccattgattaaaaatggaacttatggttcttggttaacttcaattggtttaaaaata
tatgatattctggcaagtgttgaaggtgatgataagcgaaaaatgctagataaaaaagaa
gctttgaaaattgaaccactattgccagaaaaaatattagaaggagcaggatattatgca
gaatatagaactgatgatgctcgattgacattagaagtaataaaaacggctttgaattat
aatgctgttgccttaaattattgtaaagcaaatgaatttatctatgaagaagaaaaagtt
agaggtgttgaagttgaagatttaatcgctaataaaaaatttaaaattaaggcaaaatat
gttgtgaatgcaacaggaccttgggtagataccgttcgacaaataaatcattctaaaata
ggtaagcgattacatttaacaaaaggtgttcatcttgttattgctcatgaaaaacttcct
ataaatcaggccgtttatttcgatgttcctgatggtagaatgatgtttgcaattcctagg
ggaaaaatcacatatataggaactacagataccaattatcaagaagataaagataatgtt
gctgtttctgcagtagatgctgtttatttgataagtgctgtaaataatatgttcccaaca
attaatttaaccttagacgatatacaatctagttgggctgggttacgacctttgattcat
gaagagggaaaatcggcttctgagttatctcgaaaagatgaaatttttgtttctgaaacc
gaactcatttctatcgcaggtggtaaacttactggctatcgaaaaatggctgaacgcata
gtagatatagtcgctaaaaagtataaaaaacgctatgaaaaaaaatacaagagtattaaa
actgaaaaaattactttaactggtggtgattttaagaattataaaaaggtaattaagtat
caagaatctgtttttgaacaattaaaatctgatggtttttcacaaaaagatgtaaactat
ttagttcataattatggaactcaaacagacgagatactgaaaaaatatcaagaaattaaa
agtgataacgctcaaatttcattagcaaaagcagaattatggttttctttgaattatgaa
atggctcaaacaccatcagacttttttataagaagaacggggagattatacttcgatata
gaaagtattaaaatattgaaaacggctatattaaatgaatttaaatcgttctttaattgg
gatgataaaactttaaaaaaacacgaattaaaactagaccaagcagttcatgaagcaact
aatttcactcattaa

DBGET integrated database retrieval system