KEGG   Lutibacter sp. LPB0138: LPB138_13135Help
Entry
LPB138_13135      CDS       T04497                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
lul  Lutibacter sp. LPB0138
Pathway
lul00620  Pyruvate metabolism
lul00680  Methane metabolism
lul01100  Metabolic pathways
lul01120  Microbial metabolism in diverse environments
lul01200  Carbon metabolism
Module
lul_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:lul00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LPB138_13135
  09102 Energy metabolism
   00680 Methane metabolism
    LPB138_13135
Enzymes [BR:lul01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     LPB138_13135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 LuxQ-periplasm
Motif
Other DBs
NCBI-ProteinID: AOW21562
UniProt: A0A1D8PAH3
LinkDB All DBs
Position
complement(2966534..2969125)
Genome map
AA seq 863 aa AA seqDB search
MATQPKLKRFNDNVLDKYQIYNSIFTALPFDSISNTGVLLPLFHEVCENGFANKKNPTEI
VEYFFKKYQDKPSESDQISLLFRFIQYIERQVVLFDAIEDAAFPIINNMSGVGTLRNIKE
MAKSNEKRDALIKLLNDFKVRIVLTAHPTQFYPGTVLGIITDLTKAIETGDLLKIKKLLA
QLGKTPFFKQQKPTPYDEAVNLIWYLENVFYHSFSKIYNYIQGNIGSDTSINNEVINIGF
WPGGDRDGNPFVTTEITLKVAERLRHTVLTNYFRDLRKLKRRLTFDQVKEPITELERRVY
EEITFPKNKKGKLKLEDFINQLLTIRETIITKHKSLFLDELDDLINKVKLFGFHFATLDI
RQDSRVHHTVFTELVAHLQKEGSDIFPKNYNDLSTTEQVEFLSTVKGKINDSGYNNELIE
KTIGSIYALKTIQKNNGELGCNRYIISNNQTALNVMQTFAMLNLCGFGSKLPVDVIPLFE
TVEDLKVAHTVMEELYQNKAYIKHLKNRKYKQTIMLGFSDGTKDGGYLMANWGIFKAKEN
LTQMSRKYGVKVIFFDGRGGPPARGGGKTHQFYASFGPTIENQEIQLTIQGQTISSNFGT
LESSQYNLEQLLSAGISNELFSGSKNVLTNDQKSLMEDLAQISYKTYVDFKNHPKFLPYL
EQMSTLKYYAKTNIGSRPSKRSQSDKLNFSDLRAIPFVGSWSQLKQNVPGFYGVGTALKK
YEDNGELDKVKDLYNNSDFFKTLLENSMMSLSKSFFELTSYMANDPEFGDFWKIIYEEYK
TTKRLILEVAGYSELMENSPEGKASIDIRENIVLPLLTIQQFALRKIQELKKQPNVDTKE
IEVYEKIVTRSLFGNINASRNSA
NT seq 2592 nt NT seq  +upstreamnt  +downstreamnt
atggcaacacaaccaaaattaaaacgattcaacgataatgttttagataaataccaaatc
tacaacagtatttttactgcattaccgtttgatagtattagcaatacaggagtgcttcta
ccattatttcatgaagtatgtgaaaatgggtttgctaacaaaaaaaacccaacggaaatt
gtagaatatttttttaaaaaataccaagacaaaccatctgagagtgatcaaatcagttta
ctatttagattcatccaatatatcgaaagacaagtagtattatttgacgctatagaagat
gcagcatttccaatcataaacaatatgagtggtgttggtactttgagaaacatcaaggaa
atggcaaagtcaaatgaaaaacgagatgctctaataaaactattaaatgattttaaagtt
cgaatcgttttaactgcacatccaactcaattttacccaggtacagttcttggaatcatt
accgatctaacaaaagctattgaaactggagatttattgaaaataaaaaaattattagca
caacttggaaaaactccatttttcaaacaacaaaaacctactccgtacgatgaagccgtt
aaccttatatggtatctagaaaatgttttttaccattcattttctaaaatatataactat
atccaagggaatattgggtctgatacatcaataaataatgaagtaataaatattggtttt
tggcctggtggtgatagagatggaaatccatttgtaactacggaaatcactttaaaagtt
gcagaaagattacgccatactgttttaactaattattttagagaccttagaaaactaaaa
cgacgcttgacatttgatcaagttaaagaaccaattactgaattagagcgtagagtttat
gaagagattacttttccaaaaaataaaaaaggaaaattaaaactagaagattttataaat
caacttctaactattagagaaactataataacaaagcataaatctttatttttagatgaa
ttagatgatttaattaataaagtaaaattattcggtttccatttcgctactcttgacatt
cgtcaagacagtagagtacatcacactgtttttacagaattagtagcacatcttcaaaaa
gaaggtagtgatattttcccaaaaaactataatgatttatcaacgacagaacaagttgag
tttctatctactgtcaaaggaaaaattaatgattctgggtataataatgaacttattgaa
aaaactattggttcgatttacgcactaaaaacaatacaaaaaaacaatggagaattagga
tgcaatagatacatcattagtaataatcaaactgcattaaacgtgatgcaaacatttgcc
atgcttaatttatgtggatttggaagcaaacttcctgttgatgttattccactttttgaa
actgttgaagatttaaaagtagctcatacagtaatggaagagttataccaaaataaggca
tatatcaagcacctaaaaaacagaaaatataaacaaacaatcatgcttgggttttctgac
ggaacaaaagatggtggttatttaatggcaaattggggaattttcaaagccaaagaaaac
ttgactcaaatgtcaagaaaatatggagttaaagttattttctttgatggtcgtggtgga
cctcctgcacgtggtggtggaaaaacacatcagttctacgcttcatttggaccaactatt
gaaaatcaagaaattcaattaacaattcaaggacaaacaattagttcaaactttggaact
ttagaatcatcacaatacaatttagaacaacttttaagcgctggtatttcaaatgaatta
tttagtggaagtaaaaatgttttaacaaatgatcaaaaaagtcttatggaagacttagct
caaatatcttataaaacttatgttgattttaaaaaccatccgaagttcttaccatattta
gagcaaatgagtacattaaaatattatgccaaaacaaatattggtagtagaccttctaaa
cgttctcaatcagacaaattaaatttttctgatttaagagcaattccatttgtaggatct
tggagtcaattaaaacagaatgtccctgggttttatggggtaggaacagcacttaagaaa
tatgaagacaatggagaactagataaagtgaaagacttatacaacaattcagatttcttt
aaaacattacttgaaaatagtatgatgtcattgtctaaatctttctttgaattaacttct
tatatggcaaacgaccctgaatttggagacttttggaaaattatatacgaagaatacaaa
acaactaagagattgattctggaggttgctgggtattcagaattgatggagaacagtcct
gaaggaaaagcatcaatagatattagagaaaatatagttttacctcttttaactatccaa
caatttgcgttaagaaaaattcaagaattaaagaaacaacctaatgttgacactaaagaa
attgaggtttatgaaaagattgtaactcgttctttatttggtaatattaatgcgagtaga
aattctgcataa

DBGET integrated database retrieval system