KEGG   Lutibacter sp. LPB0138: LPB138_13980Help
Entry
LPB138_13980      CDS       T04497                                 

Definition
(GenBank) peptidase
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
lul  Lutibacter sp. LPB0138
Brite
KEGG Orthology (KO) [BR:lul00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:lul01002]
    LPB138_13980
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lul04147]
    LPB138_13980
   04090 CD molecules [BR:lul04090]
    LPB138_13980
Enzymes [BR:lul01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     LPB138_13980
Peptidases [BR:lul01002]
 Metallo Peptidases
  Family M2
   LPB138_13980
Exosome [BR:lul04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LPB138_13980
CD molecules [BR:lul04090]
 Proteins
  LPB138_13980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2 Peptidase_M3
Motif
Other DBs
NCBI-ProteinID: AOW21722
UniProt: A0A1D8PAX4
LinkDB All DBs
Position
complement(3164430..3166238)
Genome map
AA seq 602 aa AA seqDB search
MKKIFFSALVITSLLSCKTESKVESQVKKDAQAFLDTYTDTFKKLYYQASEAEWAANTKI
IEGDTINAYNVQKTGEAYAKFTGSKEVIEKTRAFLESKEELDIVQIRQLEGILYSAANNP
EIVTEVVTKRIAAETAQNETLFGFDFKVDGKSVSTGDIDGVLRESNNETERLKNWEASKE
VGKKLKGGLENLVSLRNETVQALGYEDYFSYQVSDYGMNRGEMMAEMKKMVQEIWPLYRE
LHTWARYNLANKYNKEVPEYLPAHWLPNRWGQDWSALVNVEGLDIDAALKDKDPEWIVKE
GEDFFVSVGFDPLPKSFYEKSSMYPLPESTGYKKNNHASAWHMDLENDLRCLMSVEPTAD
YYETIHHELGHIYYYQAYTNPDVPPLLRGGANRGYHEAIGSLLGLAAMQKPFLAAKGLVP
VDAKVDETQNLLKEALNYVVFLPFSAGVMSEFENSLYAENLSKDEYNKKWWELAKKYQGM
VPPSERGEEFCDAASKTHINNDAAQYYDYAISYILLFQFHDHIAKNILKQDPHATNYFGS
KEVGTFLQSILSKGANCDWNDLLKESLGSGMSAKPMLDYFEPLTDYLKEQNKGRVHTLPE
KI
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatatttttttccgcactagttataacttcactattaagttgtaaaactgaa
tcaaaagttgaaagtcaagtaaaaaaagatgcacaagcatttttagacacttatactgac
acgtttaaaaaactatattaccaagcaagtgaagcagaatgggctgctaacactaaaatc
attgaaggagacactataaatgcttataatgttcaaaaaaccggagaagcctatgctaaa
tttactggaagcaaagaggtaatagaaaaaacacgagcctttttagaaagtaaagaagaa
ttagatattgttcagattcgtcagttagaaggaatactttatagtgctgctaataaccct
gaaattgttacagaagttgttacaaaaagaattgcagcagaaactgcacaaaatgaaact
ttatttggatttgactttaaagttgatggaaaatctgtttcaactggtgatattgatgga
gttttaagagaatcaaataatgaaactgaaagactaaaaaactgggaagcatcaaaggaa
gttggaaaaaaattaaaaggtggattagaaaaccttgtttcattgagaaatgaaaccgtt
caagcattaggctatgaggactacttttcttatcaagtttcagattatggaatgaataga
ggagaaatgatggcagaaatgaaaaaaatggttcaagaaatatggccattatatcgtgaa
ttacatacttgggctcgttataatttagcaaataaatataataaagaagtacctgaatac
cttcctgctcattggttacctaatcgttggggacaagattggagtgccttagtaaatgtt
gaaggtttagatattgatgcagcattaaaagacaaagatcctgaatggatagttaaagaa
ggtgaagatttctttgtgagtgtaggttttgatccattaccaaaaagtttttacgaaaaa
tcaagtatgtatccactacctgaaagcacaggttataagaaaaataatcacgcaagtgca
tggcacatggacttagaaaacgacttacgttgtttaatgagtgttgagccaactgctgat
tattatgaaacaattcaccatgaattaggacatatttattattatcaagcatatacaaat
cctgatgttcctccattattaagaggaggtgcaaatcgtgggtatcatgaagcgattgga
agtttattaggattagcagcaatgcaaaaaccttttttggctgcaaaaggtttagttcct
gttgatgctaaagttgatgaaacacaaaacttattaaaagaggcactaaattatgttgtt
ttcttacctttttcagctggtgttatgagtgaatttgaaaactctttatatgccgaaaat
ttatcaaaagatgagtacaataaaaaatggtgggagttagctaaaaaatatcaaggaatg
gttccaccatctgaaagaggtgaagaattttgtgatgctgcatctaaaacacatattaat
aatgatgctgcacaatattatgattatgccatttcgtacattttactgtttcaattccac
gatcatattgcaaaaaatatcttaaaacaagatcctcatgccaccaactactttggaagt
aaagaagttggtacttttttacaaagtatattaagcaaaggtgcaaattgcgactggaat
gacttgttaaaggaaagtcttggaagcggtatgagtgcaaagccaatgttagattatttt
gaacctttaactgattatttaaaagaacaaaataaagggagagtacatacactgccagaa
aaaatttaa

DBGET integrated database retrieval system