KEGG   Luteimonas sp. 100111: CNR27_02855Help
Entry
CNR27_02855       CDS       T05077                                 

Definition
(GenBank) DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
lum  Luteimonas sp. 100111
Pathway
lum03030  DNA replication
lum03410  Base excision repair
lum03420  Nucleotide excision repair
lum03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:lum00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    CNR27_02855
   03410 Base excision repair
    CNR27_02855
   03420 Nucleotide excision repair
    CNR27_02855
   03430 Mismatch repair
    CNR27_02855
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:lum03032]
    CNR27_02855
   03400 DNA repair and recombination proteins [BR:lum03400]
    CNR27_02855
Enzymes [BR:lum01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     CNR27_02855
    6.5.1.6  DNA ligase (ATP or NAD+)
     CNR27_02855
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     CNR27_02855
DNA replication proteins [BR:lum03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    CNR27_02855
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     CNR27_02855
DNA repair and recombination proteins [BR:lum03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     CNR27_02855
   NER (nucleotide excision repair)
    Other NER factors
     CNR27_02855
   MMR (mismatch exicision repair)
    Other MMR factors
     CNR27_02855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_OB_2 DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: ATD66523
UniProt: A0A290XBR8
LinkDB All DBs
Position
623431..624300
Genome map
AA seq 289 aa AA seqDB search
MRRHHRSRAHVALTVLLWLVSIPLQAAAPSPPALMLARDLGTTQIDVPAYYVSEKLDGVR
ARWDGRALWTRAGHRIATPPAFVAGWPDTPMDGELWVARGRFDVVSGIARSSRPDPAAWE
AVRFMVFDLPAHAGPFSERVVAMRALVAQTARPQLRAVEQTRMTTRAALDARLAQVVAAG
GEGLMLHHADAHYGVGRSAALLKLKPHDDAEARVVAHTPGKGKYAGVLGALVVEHHDGRR
FRIGTGFTDAQRANPPPPGSWVTYRYNGLTSTGLPRFARFMRTRDEMPP
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgcgacgccaccatcgctcccgcgcccacgtggcactgacggtcctgttgtggctggtc
tcgataccactgcaggcagctgcgccatcgccgcccgcgctgatgctcgcccgggacctc
ggcaccacgcagatcgacgtgccggcgtactacgtcagcgaaaagctcgacggcgtgcgt
gcgcgctgggatggccgggcgctgtggacgcgcgctggccaccgcatcgccacgccgccg
gcattcgtcgcgggttggccggatacgccgatggatggcgagttgtgggtcgcgcgcggc
cgcttcgatgtcgtcagcgggattgcacggagctcccggcccgatcccgcggcctgggag
gcagtgcgcttcatggtgttcgacctgccggcgcatgcgggcccgttctcggaacgtgtg
gtggcgatgcgcgccctggtcgcgcagacggcacgcccgcagctgcgggcggtcgaacag
acccggatgacgacacgcgccgcgctcgacgcacgcctcgcgcaggtcgtcgccgccggc
ggcgaaggactgatgctgcaccacgccgacgcacattacggcgtcgggcgcagcgccgcc
ctgctcaaactcaaaccgcatgacgacgccgaagcacgcgtggtcgcgcacacgcccggc
aagggcaagtacgcgggcgtgctcggtgcgctggtggtcgagcatcacgatgggcgtcgc
ttccggatcggcaccggtttcaccgacgcccagcgcgccaacccgccgccgcccggcagc
tgggtgacctatcgctacaacggcctcacctcgaccggcctgccgcgcttcgcacgcttc
atgcgcacccgcgacgagatgcctccctag

DBGET integrated database retrieval system