KEGG   Luteimonas sp. 100111: CNR27_03255Help
Entry
CNR27_03255       CDS       T05077                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
lum  Luteimonas sp. 100111
Brite
Enzymes [BR:lum01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CNR27_03255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: ATD66590
UniProt: A0A290XBU5
LinkDB All DBs
Position
717316..717930
Genome map
AA seq 204 aa AA seqDB search
MHKSRFLLPIPAALALALAACGGADRSADDSDNAAAQADRAADTTGTTPGDSAATTVAIV
ALQPTQGNQTAGELRFTPGNGRVDVTGTVTGLPPGGTHGFHVHENGDCSAPDASSAGGHF
NPAGSAHGRVGHGDHHAGDSDNISAGADGTAQVVGWLEGVTLGDGAVTDIVGKAVIVHKD
ADDYTTQPTGNAGDRLACGVIKAN
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgcacaagtcccgtttcctgctgccgatcccggccgcgctggcccttgcgctggccgcc
tgcggcggcgccgatcgcagcgccgatgacagcgacaatgcagcggcgcaggcggatcgc
gctgcggatacgaccggcaccacgccgggcgacagcgccgcgacgacggtcgcgatcgtc
gcgctgcagccgacccagggcaaccagaccgccggcgaactgcgcttcacgcccggcaat
ggccgcgtcgacgtcaccgggaccgtgaccggcctccctcccggcggcacccatggcttc
catgtgcatgagaacggcgactgcagcgcacccgacgcgagcagcgccggtggccacttc
aatcccgccggcagcgcccatggccgcgtcgggcatggcgaccaccatgccggcgacagc
gacaacatcagcgcaggtgccgacggcaccgcgcaggtcgtgggctggctcgaaggcgtg
acactcggcgatggcgccgtgaccgacatcgtcggcaaggcggtgatcgtccacaaggac
gccgacgactacaccacccagccgaccggcaatgccggcgaccgcctggcctgcggcgtg
atcaaggccaactga

DBGET integrated database retrieval system