KEGG   Luteimonas sp. 100111: CNR27_03680Help
Entry
CNR27_03680       CDS       T05077                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
lum  Luteimonas sp. 100111
Pathway
lum00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:lum00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CNR27_03680
Enzymes [BR:lum01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     CNR27_03680
Transporters [BR:lum02000]
 Other Transporters
  Pores ion channels [TC:1]
   CNR27_03680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2
Motif
Other DBs
NCBI-ProteinID: ATD66660
UniProt: A0A290XC15
LinkDB All DBs
Position
817847..818482
Genome map
AA seq 211 aa AA seqDB search
MANEALVLYTNPMSRGRIARWMLEEVGQPYRVELTGYDGAMRAPEFLALNPMGKVPVLVH
EGVVVTETAAICAYLAETFPQAGLLPAPTPAARAAYYRWMFFAAGPLEAAVSAKALDLLA
PPERAGTVGYGSFERTVDTLEHAAASAAPWLTGERFTAVDVYAGAQVIWGQLFKSLPPRP
AFVEYAARLQARPAWQRATALDDAAMPTPAD
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
gtggccaacgaagcgcttgtcctctataccaacccgatgtcgcgcggccgcatcgcgcgc
tggatgctcgaggaagtcggccagccctatcgtgtcgagctgaccggttacgacggtgcc
atgcgcgccccggagtttctcgcgctcaacccgatggggaaggtgccggtgctggtgcat
gaaggggtcgtggtcaccgagaccgcggccatctgcgcctatctcgccgagacctttccg
caggccggcctgctgcccgcgccgaccccggccgcgcgcgctgcctactaccgctggatg
ttcttcgccgccggcccgctcgaggccgcggtctcggcgaaagcgctcgacctgctggcg
ccgccggagcgtgcgggcacggtcggctatggcagcttcgagcgtaccgtcgatacgctt
gagcacgcggccgcatccgcagcgccctggctcaccggcgagcgcttcaccgcggtggac
gtctatgccggcgcgcaggtcatctgggggcagctgttcaagtcgctgccgccgcggccc
gcgttcgtcgaatacgccgcccggctgcaggcgcgtcctgcctggcagcgcgcgaccgcg
ctcgacgatgcggcgatgcccacgcccgcggattga

DBGET integrated database retrieval system