KEGG   Luteimonas sp. 100111: CNR27_04510Help
Entry
CNR27_04510       CDS       T05077                                 

Definition
(GenBank) serine-type D-Ala-D-Ala carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
lum  Luteimonas sp. 100111
Pathway
lum00550  Peptidoglycan biosynthesis
lum01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lum00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CNR27_04510
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:lum01002]
    CNR27_04510
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lum01011]
    CNR27_04510
Enzymes [BR:lum01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     CNR27_04510
Peptidases [BR:lum01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   CNR27_04510
Peptidoglycan biosynthesis and degradation proteins [BR:lum01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   CNR27_04510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase Peptidase_S13 Transpeptidase
Motif
Other DBs
NCBI-ProteinID: ATD66799
UniProt: A0A290XCI0
LinkDB All DBs
Position
998581..999786
Genome map
AA seq 401 aa AA seqDB search
MLLVAAATAMVGIAVAQDPAPRPQPAATPAAAAPAASDDLPTPPPPAITGTAWILMDYAT
GQMLAGHNPDERVEPASITKVMTSYVIAAELAAGKIKPDDQVLMSENAWRKGGAGTDGSY
SGFPVNQTAPLLDMEIGMVVQSGNDAAIALAEHVAGSEEAFAQLMNAYAARIGMKNSQFE
NATGLSGPEHYSTARDLAILGRAMVRDFPEEYAHNKIKEFTVGPITQHNRNRLLWRDDSV
DGIKTGHHSGAGYCLMASAQRGDQRLISVVMGSTSEAQRATDSLALLNWGFRFFETHAVY
DAEKSVATQKVWKGKTDEVQLGVAEPMLVSMPRGKYAQLKPSMDIPQTIIAPIEKGQQIG
TVRVMLDDEVVAERPLVALEAVEEAGFFKRLWHEFLMWWNA
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgctgctggtggccgcggccaccgcgatggtcggcatcgccgtcgcccaggatcccgcg
cccaggccgcagccggcagccacgccggcggccgccgcgcccgcggctagcgacgacctg
ccgaccccgccgccgcccgcgatcaccggcaccgcctggatcctgatggattacgcgacc
ggccagatgctggcgggccacaatcccgatgagcgcgtcgagccggccagcatcaccaag
gtgatgaccagctacgtgatcgccgccgaactcgccgccggcaagatcaagcccgacgac
caggtgctgatgagcgagaacgcctggcgcaagggcggcgccggcaccgatggcagttac
agcggttttccggtcaaccagaccgcgccgctgctggacatggaaatcggcatggtcgtg
cagtcgggcaacgacgccgcgatcgcgctggccgagcacgtcgccggcagcgaggaagcc
ttcgcccagctgatgaatgcctacgccgcgcgcatcggcatgaagaacagccaattcgag
aacgcgaccggtctttcaggccccgagcactattcgaccgcgcgcgacctggcgatcctc
ggccgcgcgatggtgcgcgacttccccgaggagtacgcgcacaacaagatcaaggaattc
accgtcgggccgatcacccagcacaaccgcaaccgcctgctgtggcgcgacgattccgtc
gacggcatcaagaccggccaccacagtggcgccggctattgcctgatggcctcggcccag
cgcggcgaccagcgtctgatctcggtggtcatgggttcgaccagcgaggcgcagcgcgcc
accgattcgctggcgctgctcaactggggcttccgcttcttcgagacccatgccgtctat
gacgcggaaaagtcggttgcgacgcagaaggtctggaagggcaagaccgacgaagtgcag
ctgggtgtcgccgagccgatgctggtgtcgatgccgcgcggcaagtacgcgcagctcaag
ccgtcgatggacattccgcagacgatcatcgcgccgatcgagaagggccagcagatcggc
accgtgcgcgtgatgctcgacgacgaggtggttgccgagcgcccgctggtggcgctcgag
gcggtcgaggaagccggtttcttcaagcgcctgtggcacgagttcctgatgtggtggaac
gcctga

DBGET integrated database retrieval system