KEGG   Luteimonas sp. 100111: CNR27_05270Help
Entry
CNR27_05270       CDS       T05077                                 

Definition
(GenBank) UDP-N-acetylmuramate--L-alanine ligase
  KO
K01924  UDP-N-acetylmuramate--alanine ligase [EC:6.3.2.8]
Organism
lum  Luteimonas sp. 100111
Pathway
lum00471  D-Glutamine and D-glutamate metabolism
lum00550  Peptidoglycan biosynthesis
lum01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lum00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    CNR27_05270
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CNR27_05270
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lum01011]
    CNR27_05270
Enzymes [BR:lum01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.8  UDP-N-acetylmuramate---L-alanine ligase
     CNR27_05270
Peptidoglycan biosynthesis and degradation proteins [BR:lum01011]
 Precursor biosynthesis
  Amino acid ligase
   CNR27_05270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase Mur_ligase_M Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: ATD66923
UniProt: A0A290XCW5
LinkDB All DBs
Position
1155197..1156660
Genome map
AA seq 487 aa AA seqDB search
MIRRLHQTRGLSKEDFAKVFSRVHFVGIGGTGMSGIAEVLCTLGYKVSGSDTADSATTRR
LASLGATVHRGHAAANVLGSDCVVVSSAIRPDNPELMEARAQRIPIVPRAEMLAELMRFR
RSIAVAGTHGKTTTTSLTASVLAEGGLDPTFVVGGQLLAAGANARLGSGDWLVAEADESD
GSFLRLNPLIAIVTNIDADHLENYGGDFTRVQAAFDEFLHRLPFYGLAVLCIDDPEVARL
ATATPRHVMTYGLSDAADVRAEDVAQDGAAMTFTLCLPENTRIRARLALPGRHNVLNALA
AAAVGWQLGVAPEAIVAALGAFQGIGRRFNLLGELVTPAGARVQLVDDYGHHPKELAAVF
AAARGGWSDRRLVVAFQPHRYSRTRDLFDDFAGVLSDVDALVLTEVYPAGEAPIAGADAK
ALARAIRARGRIDPVVVAGAADLAGVLPDILEDGDLLLMMGAGDIGVAVQRLAQAGFIGA
ARPEAGR
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgatccgtcgtctccaccagacccgcggcctgtcgaaggaagacttcgccaaggtgttc
tcgcgcgtgcatttcgtcggcatcggcggcaccggcatgagcggcatcgccgaagtgctg
tgcacgctgggctacaaggtgtcgggctccgacaccgccgacagcgcgaccacgcgccgg
ctcgcgagccttggcgcgaccgtgcatcgcggccatgcggcagccaatgtactgggcagc
gactgcgtggtcgtgtccagcgcgatccggcccgacaatccggaactgatggaggcgcgc
gcgcagcgcatcccgatcgtgccgcgcgcggagatgctggccgaactgatgcgcttccgc
cgcagcatcgcggtggccggtacccacggcaagaccacgaccacgtcactgaccgcgagc
gtgctcgccgaaggcggcctcgatccgaccttcgtcgtcggcggccagctgctggctgcc
ggcgcgaacgcgcgcctgggcagtggcgactggctcgtcgccgaggcggacgagagcgac
ggcagcttcctgcgcctcaatccgctgatcgcgatcgtcaccaatatcgacgccgaccac
ctggagaactacggcggtgatttcacccgcgtccaggccgcgttcgacgaattcctgcat
cgactgccgttctatggactcgcggtgctgtgcatcgacgatcccgaggtcgcgcgcctg
gccacggccacgccgcgccacgtgatgacctacggcctgtcggatgccgccgacgtgcgt
gccgaggacgtcgcccaggacggcgcggcgatgaccttcacgctgtgcctgcccgaaaac
acgcgcatccgcgcgcggcttgcgctgcccggccgccacaatgtgctcaatgcactcgcc
gcagccgcggtgggctggcagctcggcgtcgcccccgaggcgatcgtcgccgcgctgggt
gcgttccagggcatcggccgccgcttcaacctgctcggcgagctggtcacgcctgccggc
gcccgcgtacagctggtcgacgactacggccatcatcccaaggagctggcggcggtgttc
gccgcggcgcgcggaggctggagcgatcgccgcctcgtggtcgcattccagccacaccgc
tacagccgcacccgcgacctgttcgacgacttcgccggcgtgttgtcggatgtcgatgca
ctggtgttgaccgaggtctatcccgcgggcgaggcgccgattgcgggcgccgatgcgaag
gcactcgcacgcgcgatccgcgcgcgcggccggatcgatccggtcgtcgttgccggcgcc
gcggatctggccggcgtgctgcccgacatcctcgaagatggcgacctgctgctgatgatg
ggcgccggcgacatcggcgtcgccgtgcagcgcctcgcgcaggcaggtttcatcggcgca
gcgcgcccggaggcgggccgatga

DBGET integrated database retrieval system