KEGG   Luteimonas sp. 100111: CNR27_05275Help
Entry
CNR27_05275       CDS       T05077                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
lum  Luteimonas sp. 100111
Pathway
lum00473  D-Alanine metabolism
lum00550  Peptidoglycan biosynthesis
lum01100  Metabolic pathways
lum01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lum00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CNR27_05275
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CNR27_05275
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CNR27_05275
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lum01011]
    CNR27_05275
Enzymes [BR:lum01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CNR27_05275
Peptidoglycan biosynthesis and degradation proteins [BR:lum01011]
 Precursor biosynthesis
  Amino acid ligase
   CNR27_05275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_4 CPSase_L_D2 ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: ATD66924
UniProt: A0A290XCN3
LinkDB All DBs
Position
1156657..1157616
Genome map
AA seq 319 aa AA seqDB search
MSATLSAPRFTEPGVFGRVAVLLGGSGSEREVSLQSGQGVLDALRSRGVDAHAVDGVPAL
AQAILAGKFDRVFNILHGGDGENGVVQGLLEAFGIPCTGSGVLGSALTMDKIRTKQVWMS
EGLPTPRFARLAPGADLHAAAASLGYPVFVKPSCEGSSVGVFRVISEADLQPAVEFAAGY
AGELLMEQMVRGDELTVGIIGDIALPSIRIVPAGEWYDYHAKYIADDTQYLCPGMSPEDE
AEVGALALAAFRAAGCSGWGRVDVMRDIERGLQLIEVNTAPGMTSHSLVPKAAAQIGMDY
AALCWRVLEATIPVEVEAR
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccacgctgtccgcaccccgtttcaccgagccgggcgtgttcggccgcgttgcg
gtgctgctcggcggctcgggctcggagcgggaggtctcgctgcagtcggggcagggggtg
ctcgatgcgctgcgctcgcgcggcgtcgatgcgcacgcggtcgacggggtgccggcgctc
gcacaggcgatcctcgccggcaagttcgaccgcgtgttcaacatcctgcacggcggcgac
ggcgagaacggcgtggtccagggcctgctggaggctttcggcattccctgtaccggctcg
ggcgtgctcggttccgcgctgaccatggacaagatccgcaccaagcaggtgtggatgagc
gaaggtcttccgaccccgcgcttcgcccgcctggcaccaggcgcggatctccacgctgcc
gcggcgtcgctcggctatccggtcttcgtgaagccgtcgtgcgaaggctccagcgtcggt
gtgttccgcgtgattagcgaagcggacctgcaaccggccgtcgagttcgccgccggctat
gccggcgaactgctgatggagcagatggtgcgtggcgacgagctgaccgtcggcatcatc
ggcgatatcgcgctgccgtccatccgcatcgtgcccgcaggcgagtggtacgactaccac
gccaagtacatcgccgacgacacgcagtacctgtgccccggcatgtcccccgaggacgaa
gccgaggtcggcgcgctcgcactggccgccttccgtgcggcgggctgcagcggctggggc
cgcgtcgacgtcatgcgcgacatcgagcgtggcctgcagctgatcgaggtcaataccgcg
cccggcatgaccagtcattcgctggtgcccaaggctgctgcgcagatcggaatggattac
gcggcgctgtgctggcgcgtgctcgaagccacgattccggtggaggtggaagcgcgatga

DBGET integrated database retrieval system