KEGG   Luteimonas sp. 100111: CNR27_05905Help
Entry
CNR27_05905       CDS       T05077                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
lum  Luteimonas sp. 100111
Brite
KEGG Orthology (KO) [BR:lum00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CNR27_05905
Enzymes [BR:lum01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CNR27_05905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like AlaDh_PNT_C FAD_binding_3 FAD_oxidored Glutaredoxin NAD_binding_7 DAO Thi4 FMO-like K_oxygenase Thioredoxin_4 NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ATD67035
UniProt: A0A290XD12
LinkDB All DBs
Position
complement(1300974..1302566)
Genome map
AA seq 530 aa AA seqDB search
MLEADLKAQLKAYLERAVRPIQIVASVDDSEKSRELLSLLEDLKEASPKISVDATGTDPR
KPSFLITSPGLDIDVRFAGLPMGHEFTSLVLALLQVGGHPSKAAKDTIEQVMALEGDYLF
ETYYSLSCQNCPDVVQALNLAAVLNPRIRHVAIDGALFQAEVEAREIMSVPTVFLNGSKF
DQGRMTLEQIVAKLDTGAADRAAQAIAGKAPFEVLVVGGGPAGAAAAIYAARKGIRTGVA
SERFGGQVLDTMAIENFISVKETEGPKMAAALEQHVREYDVDIMDLQRAVQLVPAGDDGL
VGIGLENGATLRSRTVVLATGARWRQMGVPGEDQYRNKGVAYCPHCDGPLFKGKRVAVIG
GGNSGVEAAIDLAGIVAHVTLIEFDAQLRADEVLQRKLRSLSNVRIVTSAQTTEVLGDGA
RVNGLVYRDRVGGDSHRIELEGVFVQIGLLPNTEWLKGTVELSPRGEIIIDERGQTSVPG
VFAAGDATTVPYKQIVIAMGQGATAALSAFDHLIRTSAPAAATTAQTESA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgttggaagccgatctcaaggcgcagttgaaggcttatctggagcgcgcggtgcgcccg
atccagatcgtggcctcggtcgacgacagcgagaagtcgcgcgagctgctctccctgctc
gaggacctgaaggaagcgagcccgaagatcagcgtcgatgccaccggcactgacccgcgc
aagccctcgttcctgatcacctctcccggcctcgacatcgacgtccgcttcgccggcctg
ccgatgggccacgagttcacctcactggtgctggccctgctacaggtgggcggccatccg
tcgaaggcggccaaggacacgatcgagcaggtgatggccctagagggcgactatctgttc
gaaacctactactcgctctcgtgccagaactgcccggacgtggtgcaggcgttgaacctc
gccgccgtgctcaacccgcggatccgccacgtggcgatcgacggtgcgctgttccaggcg
gaagtcgaggcgcgcgagatcatgtcggtgccgacggtgttcctcaacggcagcaagttc
gaccagggccgcatgacgctcgagcagatcgtcgccaagctcgataccggcgccgccgat
cgcgcggcgcaggcgattgccggcaaggctccgttcgaggtgctggtggtgggcggcggc
ccggccggcgcggcggcggcgatctatgcggcacgcaagggcatccgcaccggcgtcgcg
tccgaacgcttcggtggccaggtgctcgacacgatggcgatcgagaacttcatctcggtc
aaggagaccgagggcccgaagatggcggccgcgctggagcagcatgtgcgcgagtacgac
gtcgacatcatggacctgcagcgcgcggtgcagctggtgccggccggcgacgacggcctg
gtcggaatcgggctcgagaacggcgccacgctgcgctcgcgcaccgtggtgctggccacc
ggcgcccgctggcggcagatgggcgtgcccggcgaggaccagtaccgcaacaagggcgtg
gcgtattgcccgcactgcgatggcccattgttcaagggcaagcgtgtggcggtgatcggc
ggcggcaactccggcgtcgaagccgcgatcgatctggccggcatcgtcgcccacgtcacc
ctgatcgagttcgatgcccagctgcgtgccgacgaggtcctgcagcgcaagctgcgcagt
ctgtcgaacgtgcgcatcgtcaccagcgcgcagaccaccgaggtcctcggcgacggcgcc
agggtcaacggcctggtgtacagggaccgcgttggcggcgacagccaccgtatcgaactt
gaaggcgtgttcgtgcagatcggcctgctgcccaacaccgaatggctcaagggcacggtc
gagctgtcaccgcgcggcgagatcatcatcgacgagcgcggccagacctcggtgccgggc
gtgttcgctgccggcgacgcgacgacggtgccgtacaagcagatcgtcatcgcgatgggc
cagggtgcgaccgctgcgctcagcgctttcgaccacctgatccgcacctcggcgccggcc
gccgcgacgacggcacagaccgaatccgcgtga

DBGET integrated database retrieval system