KEGG   Luteimonas sp. 100111: CNR27_11825Help
Entry
CNR27_11825       CDS       T05077                                 

Definition
(GenBank) peptidase M20
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
lum  Luteimonas sp. 100111
Brite
KEGG Orthology (KO) [BR:lum00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:lum01002]
    CNR27_11825
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lum04147]
    CNR27_11825
   04090 CD molecules [BR:lum04090]
    CNR27_11825
Enzymes [BR:lum01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     CNR27_11825
Peptidases [BR:lum01002]
 Metallo Peptidases
  Family M2
   CNR27_11825
Exosome [BR:lum04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CNR27_11825
CD molecules [BR:lum04090]
 Proteins
  CNR27_11825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-ProteinID: ATD68032
UniProt: A0A290XFU9
LinkDB All DBs
Position
2589777..2591789
Genome map
AA seq 670 aa AA seqDB search
MIHRHALLALAVAASLTLAGCNRTASPDAGTTATDTTTPGDETADQFIARVNEELRALMP
ELTASQWLSATYINDDSQLLAAKYNERYLAQLNEWIEQARRFEGQQMTPETARAINLLKL
GAAMPPPRDPEHLAELTKIASKMEGTYGAGQYCTDEGEARSCRQLGELEDVLRSSRDYDA
QLDAWQGWHTIAQPMRADYTRFVELVNEGARDLGFADAGEAWRSGYDMPPAELAAETDRL
WGQVKPLYEQLHCYTRARLDARYPGRGTVDGGLLPAHLMGNMWQQDWGNLWDILQPYPAA
GSLDVTGALEKNYQTLLNERMVRENALIDSDRRADVAHAAKLENAKRMNQRAEDFYVSLG
MPKLPESFWTKTQFIKPRDRDVVCHASAWDMNMAGDVRTKMCTKPNEEDFTTIYHELGHI
YYDLAYNSQPPLFQGGAHDGFHEAIGDTVVLAMTPQYLQTIGLVGEQQQTQESLVNSQMR
MALAKVSFLPFGLMIDRWRWGVFDGSITPDNYNAAWWSLKAQYQGVAPPSPRGEEFFDAG
AKYHVPGNTPYTRYFLSHVLQFQFYKALCDAAGHTGPLYECSFYGNKAAGEKFWAMLQKG
NSQPWQQTLKELTGEERMDAAPVLEYFAPLQAWLAQQNEGRTCGWTAPAAAQSPAAPAAS
QPAAETPPRG
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgatccatcgccatgccctgctcgccctggcggtcgccgcgagcctgacgctcgccggc
tgcaaccgcaccgcctcccccgatgccggcacgacggccacggacaccacgacgccgggc
gacgaaaccgccgaccagttcatcgcccgggtcaacgaggaactgcgcgccctgatgccg
gagctgaccgcctcgcagtggctgtcggcgacctacatcaacgacgacagccagctgctc
gcggccaagtacaacgagcgctacctggcccagctcaatgagtggatcgagcaggcgcgc
cggttcgagggtcaacagatgacgcccgaaaccgctcgggcgatcaatctgctcaagctc
ggcgccgcgatgccgccgccccgcgatcccgaacacctcgccgagctgacgaagatcgcc
tcgaagatggaaggcacctacggcgcgggccagtactgcaccgacgagggcgaggcgcgc
agctgccgccagctcggcgagctcgaggacgtactgcgcagcagccgcgattacgacgcc
cagctcgatgcgtggcagggctggcatacgatcgcccagccgatgcgcgccgactacacg
cgcttcgtcgaactggtcaacgagggcgcacgcgacctcggtttcgccgatgccggcgag
gcctggcgctcgggatacgacatgccgcctgccgagctcgccgcggaaaccgatcgcctc
tggggccaggtcaaaccactctacgagcagctgcactgctacacccgcgcgcgcctggac
gcgcgctaccccggccgcggcacggtcgacggcggcctgctgccggcgcacctgatgggc
aacatgtggcagcaggattggggcaacctgtgggacatcctccagccctacccggctgcc
ggcagcctcgacgtgaccggtgcgctggagaagaactaccagaccctgctcaacgaacgg
atggtcagggagaacgcgctgatcgactccgatcgtcgcgccgatgtcgcccacgcggcg
aagctcgagaacgcaaagcgcatgaaccagcgcgccgaggacttctatgtatcgctcggc
atgccgaagctgccggagagcttctggaccaagacccagttcatcaagccgcgcgaccgg
gatgtcgtctgccacgccagcgcctgggacatgaacatggccggcgacgtgcgcacgaag
atgtgcaccaagcccaacgaggaagacttcaccacgatctaccacgagctgggccacatc
tattacgacctggcctacaacagccagccgccgctgttccagggcggcgcgcacgacggt
ttccacgaggccatcggcgacaccgtggtgcttgcgatgaccccgcagtacctgcagacg
atcggtctggtcggcgaacagcagcagacccaggaatcgctggtcaattcgcagatgcgc
atggcgctggccaaggtatcgttcctgccgttcgggctgatgatcgaccgctggcgctgg
ggcgtgttcgacggttcgatcacgcccgacaactacaacgccgcgtggtggtcgctcaag
gcgcagtaccagggcgtcgccccgccgagcccgcgcggcgaggagttcttcgacgccggc
gcgaagtaccacgtgccgggcaacacgccctacacgcgctacttcctgtcgcacgtgctg
cagttccagttctacaaggcgctgtgcgatgcggccggccacacagggccgctgtacgag
tgcagcttctacggcaacaaggcggcgggcgagaagttctgggcgatgctccagaagggc
aacagccagccgtggcagcagacgctcaaggaactgaccggcgaggagcggatggacgcc
gcccccgtgctcgaatacttcgcgccgctgcaggcctggctcgcccagcagaacgaaggc
cggacctgcggctggaccgcgcctgccgctgcgcagtcgcccgcagcccctgccgcctcg
cagccggctgcggagacgccgccgcgcggctga

DBGET integrated database retrieval system