KEGG   Luteimonas sp. 100111: CNR27_11890Help
Entry
CNR27_11890       CDS       T05077                                 

Gene name
fabZ
Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
lum  Luteimonas sp. 100111
Pathway
lum00061  Fatty acid biosynthesis
lum00780  Biotin metabolism
lum01100  Metabolic pathways
lum01212  Fatty acid metabolism
Module
lum_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:lum00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CNR27_11890 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CNR27_11890 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:lum01004]
    CNR27_11890 (fabZ)
Enzymes [BR:lum01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     CNR27_11890 (fabZ)
Lipid biosynthesis proteins [BR:lum01004]
 Fatty acid synthase
  Component type
   CNR27_11890 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas DUF4990 AfsA
Motif
Other DBs
NCBI-ProteinID: ATD68045
UniProt: A0A290XFX2
LinkDB All DBs
Position
2610426..2610896
Genome map
AA seq 156 aa AA seqDB search
MTQDDTRAEITLPIHIDGIQGLLPHRYPFLLVDRVVEFEPGKRVLCYKNVSANEQFFQGH
FPSQPVMPGVLVVEALAQAGGILSHLTRGKNHNGNLSYLVKVDAAKFSRMVVPGDRLELE
VSIKREIRNMTMYSGIARVDGEQAACAEILCAEVPR
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaggacgacacccgggcagagatcacgctgccgatccacatcgacggcatccag
ggcctgttgccccaccgctatccgttcctgctggtcgaccgcgtcgtcgagttcgagccc
ggcaagcgcgtgctctgctacaagaatgtctcggccaacgagcagttcttccaggggcat
tttccgagccagccggtgatgccaggcgtgctggtggtcgaagcgttggcccaggccggc
ggcatcctgtcgcacctcacccggggcaagaaccacaatggcaacctctcctacctggtg
aaggtggacgcggcgaagttctcgcgcatggtggtgccgggggaccgcctggaactcgag
gtctcgatcaagcgcgagatccgcaacatgacgatgtattcgggcatcgcccgggtcgac
ggcgaacaggccgcgtgcgcggagatcctctgcgccgaggtcccgcgctga

DBGET integrated database retrieval system