KEGG   Luteimonas sp. S-1072: E5843_11730Help
Entry
E5843_11730       CDS       T05957                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
lus  Luteimonas sp. S-1072
Brite
KEGG Orthology (KO) [BR:lus00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    E5843_11730 (ahpF)
Enzymes [BR:lus01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     E5843_11730 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like Glutaredoxin DAO NAD_binding_7 FAD_binding_3 AlaDh_PNT_C Thi4 K_oxygenase NAD_binding_8 Thioredoxin_4 FMO-like
Motif
Other DBs
NCBI-ProteinID: QCU72697
LinkDB All DBs
Position
2407441..2409030
Genome map
AA seq 529 aa AA seqDB search
MLEQDLKTQLAAYLERVVRPIHIVASLDDGAKSAEMRELLEEIASLSPQIELALDGDDAR
RPSFALGTPGHDISLRFAGLPMGHEFTSLVLALLQVGGHPSKAAAETLEQVAALEGDYNF
ETYYSLSCQNCPDVVQALNLAAVLNPNIRHVAIDGALFQDEVEAREVMSVPTVYLNGQVF
DQGRMTLEQIVAKLDTGAAAREAEKIAAKAPFDVLVVGGGPAGAAAAVYAARKGIRTGVA
SERFGGQVLDTMSIENFISVPHTEGPRMAAQLEQHVREYDVDIMDLQRAEQLIPASADGL
VELKLENGASLKSKAVILATGARWRQMNVPGENEYRNKGVAYCPHCDGPLFKGKHVAVIG
GGNSGVEAAIDLAGIVAHVTLIEFDASLRADQVLQRKLKSLPNVTVLTSAQTTEVLGDGA
KVTGLVYRDRVGGDSHRVVLDGVFVQIGLLPNTEWLKGTVDLSPRGEIMIDDRGQTSVPG
VFAAGDCTTVPYKQIVVAMGEGSKAALAAFDHLIRTSAPAASSAVAEAV
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaacaggatctcaagacccagctcgccgcctacctcgagcgcgtggtgcgcccg
atccacatcgtcgcctcgctcgacgatggcgcgaagtcggccgagatgcgcgagctgctg
gaggaaatcgccagcctgagcccgcagatcgaactggcgctcgacggcgatgacgcacgt
cggccttcgttcgcgctgggcacccccggccatgacatctcgctgcgttttgccgggctg
ccgatgggccacgagttcacctcgctggtgctggcgctgctgcaggtcggcgggcatccg
tcgaaggccgccgccgagaccctcgaacaggtcgccgcactggaaggcgactacaacttc
gaaacctactattcgctgtcgtgccagaactgccccgacgtggtgcaggcgctgaacctg
gcggcggtgctgaaccccaacatccgccacgtcgccatcgacggcgccctgttccaggac
gaggtcgaggcgcgcgaggtgatgtcggtgccgaccgtctacctcaacggccaggtgttc
gaccagggccggatgacgctcgagcagatcgtcgccaagctcgacaccggcgccgccgcc
cgcgaggcggaaaagatcgccgccaaggcgccgttcgacgtgctggtggtcggcggtggg
ccggccggtgccgccgccgcggtgtatgccgcgcgcaagggcatccgcaccggcgtcgca
tcggagcgtttcggtggccaggtgctcgacaccatgtcgatcgagaacttcatttcggtg
ccgcacaccgaaggcccgcgcatggccgcacagctggagcagcacgtgcgcgagtacgac
gtcgacatcatggacctgcagcgcgcggaacagctgatccccgccagtgccgatggcctg
gtcgagctgaagctggagaacggcgcgtcgctgaagtcgaaggcggtgatcctcgccacc
ggtgcgcgctggcggcagatgaacgtccccggcgagaacgagtaccgcaacaagggcgtg
gcgtattgcccgcactgtgacggcccgctgttcaagggcaagcacgtggcggtgatcggc
ggtggcaactccggcgtggaagccgcgatcgacctcgccggcatcgtcgcccacgtgacc
ctgatcgagttcgacgccagcctgcgcgccgaccaggtgctgcagcgcaagctgaagagc
ctgcccaacgtgaccgtcctgaccagcgcgcagaccaccgaggtgctgggcgatggcgca
aaggtgaccggcctggtctaccgcgaccgcgtgggcggcgacagccaccgtgtggtgctg
gacggcgtgttcgtgcagatcggcctgctgcccaacaccgaatggctgaagggcaccgtg
gacctgtcgccgcgcggcgagatcatgatcgacgaccgcggccagaccagcgtgccgggc
gtgttcgcggccggcgactgcaccacggtgccgtacaagcagatcgtggtcgcgatgggc
gaaggttccaaggccgcgctggccgcgttcgaccacctgatccgcaccagcgcaccggcc
gccagcagcgcggtcgccgaagcggtgtaa

DBGET integrated database retrieval system