KEGG   Lutibacter profundi: Lupro_04120
Entry
Lupro_04120       CDS       T04235                                 

Definition
(GenBank) MFS transporter permease
  KO
K06902  MFS transporter, UMF1 family
Organism
lut  Lutibacter profundi
Brite
KEGG Orthology (KO) [BR:lut00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lut04131]
    Lupro_04120
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lut02000]
    Lupro_04120
Membrane trafficking [BR:lut04131]
 Autophagy
  Other autophagy associated proteins
   Others
    Lupro_04120
Transporters [BR:lut02000]
 Major facilitator superfamily (MFS)
  Unknown transporters
   Unknown major facilitator-1 (UMF1) [TC:2.A.1.24]
    Lupro_04120
SSDB
Motif
Pfam: ATG22 MFS_1
Other DBs
NCBI-ProteinID: AMC10487
UniProt: A0A0X8G5K8
LinkDB
Position
complement(939638..940942)
AA seq 434 aa
MLKKGDKKLINGWAFYDWANSVYSLVIGTAVFPIYYESVTESDGGIIQFLGTDWHNTTAY
SYALGISFLIVAFLSPILSAIADYTGNKKRFMQFFCFLGSFSVMSLYFFTGKENVWIGIV
FTILASIGFWGSIVFYNAYLPEVAEPKDHDRVSAKGFMLGYIGSVLLLAFNLSMVMKPEI
YGITDSTFPARVSFLTVGIWWLGFAQVTFSRLPNNPFKRKPEKDYIFKGYRELKIVLQEI
KKQSQLKILLISFFLYSIGVQTVILLASIFGTKDLGLETSNLIITILLIQLVGIVGAFAF
SRLSEKIGNIKALKITILIWSVACVGAYTLHREDPDVYLKFYALGGFIGLVLGAIQTLSR
STYSKLIPDTTQDHATYFSFYDVTEKLAIVFGMALAGIVTSYTNSLRLFILILAVFFIAG
FVTLSFMKGSKYVK
NT seq 1305 nt   +upstreamnt  +downstreamnt
atgttaaaaaaaggcgacaaaaaattaatcaatggttgggcattttatgattgggcaaac
tcagtatattcattggtaattggcacagctgtttttcccatttattatgaatcagttaca
gaatcagatggtggaattattcagtttttaggaacagattggcataatacaacggcgtat
tcttatgcattaggaatttcgtttttgatagtagcatttttatctcctattttatcagca
attgctgattatacagggaataaaaaaagatttatgcaatttttctgttttttgggctcc
ttttcagttatgtcactttacttttttacaggaaaagaaaatgtttggattggtattgta
ttcaccattttagcgagtattggtttttggggaagtattgttttttacaatgcatattta
cctgaagttgctgaaccaaaagaccatgaccgtgtaagcgcaaaagggtttatgcttggg
tatataggctcagttttgttattggcatttaatttatcgatggttatgaaaccagaaata
tatggtattacagattcaacatttcctgcgcgagtttcatttcttaccgttggtatttgg
tggttaggttttgcacaagttacttttagtcgtttacctaataatccttttaaaagaaag
cctgaaaaagattatatttttaaaggatatagggagctaaaaatagtgctccaagagata
aaaaaacaaagccagctaaaaatattattaatttcttttttcttgtatagtattggggtt
cagactgttattttgttggcttctatctttggaacgaaagatttaggattagaaaccagt
aatttaattattacaattttattaatacaattagttggaatagtaggagcgtttgccttt
tcaaggttgtcagaaaaaattgggaatattaaagctttaaaaataacgatattaatatgg
agtgttgcctgtgtgggggcttatacactccatagagaagatccggatgtgtatttgaaa
ttttatgctttaggagggtttataggacttgttttaggggctattcaaacgctgtcgaga
tcaacgtattccaaattaattccagatacaactcaagatcacgcaacgtattttagtttt
tatgatgttactgaaaaattagccattgtttttggtatggcattggcagggatagttaca
tcatacacaaattcattacgattatttattttaattttagcagtcttttttattgcgggt
tttgtaactttaagctttatgaaaggctcaaaatatgttaaataa

DBGET integrated database retrieval system