KEGG   Lutibacter profundi: Lupro_04125
Entry
Lupro_04125       CDS       T04235                                 

Definition
(GenBank) peptidase M48
Organism
lut  Lutibacter profundi
SSDB
Motif
Pfam: Peptidase_M48 Peptidase_M13 CotJB
Other DBs
NCBI-ProteinID: AMC10488
UniProt: A0A0X8G5P0
LinkDB
Position
complement(941029..941838)
AA seq 269 aa
MKKIIALTVVLLFMVSCSTVPITGRKRINIVSDAQILPASFAQYEGFLKENKISTNVKKT
NELQHVGMNISKAVDKFMRANGMVKEANSYRWEFNLIEDKTINAWCMPGGKVVFYTGILP
VCKNTDGIAAVMGHEVAHAFAKHGQERMTSAYGQQLGGIAVALASNKKDPKTRALWNTIY
GVGSTVGMLAYSRTHETEADKLGMVFMAMAGYNPNEAINLWIRMSQQSKGSKPPEFLSTH
PSDQTRIKNLKAYLPTAIALAKKYNTQQP
NT seq 810 nt   +upstreamnt  +downstreamnt
atgaaaaaaataatagctctaactgtagttttactatttatggtaagttgtagcaccgta
ccaattacagggcgaaaaagaattaatattgtaagtgatgctcaaattttacccgcaagt
tttgctcaatatgaagggtttttgaaagaaaataaaatttcaacaaatgtaaaaaagacc
aatgaattacaacatgttggaatgaatatttcaaaagcggtagataagtttatgagagca
aacggcatggttaaagaagcaaatagttatcgctgggaatttaacttaattgaagataaa
acaataaatgcttggtgtatgcctggaggaaaagtagttttttatacaggaattttacct
gtttgtaaaaatactgatggaattgcagctgttatgggacatgaagttgctcatgcgttt
gctaaacatggacaagagagaatgacaagtgcttatggacagcaattaggaggaatagcc
gttgctttggcaagcaataagaaagatccaaaaacgcgagcattgtggaatactatttac
ggagtaggttctactgtaggaatgttggcttatagtagaactcatgaaacagaagctgat
aaactaggtatggtatttatggctatggctggatataatccaaatgaggctattaattta
tggattagaatgagccaacaatctaaaggaagtaaacctccagaatttttaagtacgcat
ccatcagatcaaactcggattaaaaacttaaaagcttacttgccaactgctattgcttta
gcaaaaaaatataatacgcaacaaccataa

DBGET integrated database retrieval system