KEGG   Lutibacter profundi: Lupro_04465Help
Entry
Lupro_04465       CDS       T04235                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
lut  Lutibacter profundi
Pathway
lut00500  Starch and sucrose metabolism
lut01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lut00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Lupro_04465
Enzymes [BR:lut01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Lupro_04465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1939 Alpha-amylase
Motif
Other DBs
NCBI-ProteinID: AMC10538
UniProt: A0A0X8G6H6
LinkDB All DBs
Position
complement(1011930..1013318)
Genome map
AA seq 462 aa AA seqDB search
MKPLKIYFQLILLSTLFLVACSKENIEELPRLEGKIKSITHETSARTGLKPIGLGVMMQA
FYWDVPSGGTWWNTVKGKVQSWSDVGIDAIWLPPASKAQNGAFSMGYDPFDYYDLGEYNQ
MGSVETRFGSKTELIDLINASHSAQLSVIADIVINHNSGGASEANPITGTNTWTSFTPLS
GKFNRTYDDFHPNSNHSSDSGYFGGFPDLCHHQINVQNWLWKDTESVAKYYKDVIGFDGW
RFDYVKGFEPWVVKDWITEVGGFSVGEYWDSNVNTLDWWTTQSQASAFDFACYYKMNEAF
DGNNLNKLNDDMLWKRNASKAVTFVTNHDTDEIFSGKMLAYAYILTHEGYPTIFYRDYEE
WLDKERLNNLIWIHNNLAGGTTNILYTDTDEYIAKRNGYNNAGLVVYINNSNYWQERWIE
TNWSNTTIKDYTGFSNWEPTTQSGNWVKIQAPPKSYSVWAPK
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccccttaaaatttattttcaattaatactattaagtactctttttttagttgca
tgctctaaggaaaatatagaagaattacctcggttagaaggtaaaattaaatcaattaca
catgaaacttctgctagaacaggtttaaaacctataggtttaggagttatgatgcaagct
ttttattgggatgtaccatctggaggaacttggtggaatacagtaaaaggtaaagttcaa
agttggagcgacgtaggaatagatgctatatggcttccgccagcttcaaaagcccaaaat
ggcgctttttcaatggggtatgatccttttgattattacgatttaggtgagtataaccaa
atgggtagtgtagaaacgcgttttggttcaaaaactgaattaatagacttgattaatgct
tctcactcagctcaattaagtgtaatagctgatattgttatcaatcataacagtggaggg
gcaagtgaagccaatcctattactggtacaaatacatggactagttttacgccattatca
ggaaagtttaatagaacatatgatgattttcatccaaatagtaatcacagttccgattct
ggttactttggaggttttcctgatttatgtcatcatcaaataaatgtacaaaattggtta
tggaaagatacagaatctgtagctaaatattataaagatgttataggttttgatggttgg
cgttttgattatgtgaaagggtttgaaccctgggtagttaaagattggattacagaagtt
ggagggtttagtgttggtgaatactgggattcaaatgtaaatactttagattggtggaca
actcagtcacaagcaagtgcttttgattttgcttgttattataaaatgaatgaagcattt
gatggaaataatttaaataaattgaatgatgatatgttgtggaaacggaatgcaagtaaa
gcagtgacctttgtaacaaatcatgataccgatgaaattttttcaggaaaaatgttagca
tacgcttatattttgactcatgaagggtatcctactatcttttatagagattatgaggaa
tggttagataaagaaagattaaataatttaatttggattcataataatttggctggcggt
actacaaatattttatatacagatacagatgagtatattgcaaaaagaaatggttacaat
aacgcgggattagttgtttatataaataattcaaattattggcaagaacgttggattgaa
accaattggtcaaacacaacaataaaagactatacaggtttctcaaattgggaaccaact
actcaatctggtaactgggtaaaaatacaagcaccacctaaaagttattctgtttgggct
ccaaaataa

DBGET integrated database retrieval system