KEGG   Lutibacter profundi: Lupro_10650Help
Entry
Lupro_10650       CDS       T04235                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
lut  Lutibacter profundi
Pathway
lut00620  Pyruvate metabolism
lut00680  Methane metabolism
lut01100  Metabolic pathways
lut01120  Microbial metabolism in diverse environments
lut01200  Carbon metabolism
Module
lut_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:lut00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Lupro_10650
  09102 Energy metabolism
   00680 Methane metabolism
    Lupro_10650
Enzymes [BR:lut01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Lupro_10650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AMC11698
UniProt: A0A0X8G7V8
LinkDB All DBs
Position
complement(2418075..2420663)
Genome map
AA seq 862 aa AA seqDB search
MHKSPKLTRFNENVLAKYQIYNSIFMTLPFDTITKTGVLLPLFHDVCENGFLNKKNPTEI
VETFFKTYQENPTETEKINLLFKFIQYIERQVVLFDAIEDAAFPIVNNMDGVGTLRNSKE
MASLENKKEDLKNYLKNFKVRVVLTAHPTQFYPGTVLGIITDLTEAIENNNLLLINKLLA
QLGKTPFFKHEKPTPFDEAINLIWYLENVFYHSISKVYSYIQSNILNGELIDNEIINLGF
WPGGDRDGNPFVTTQITLDVAKRLKQTILKNYYKDIRLLKRRLTFDGVEQPILELEKMIF
ENSVNSDFKTLLPLNLFKEKLFQIKETLITKHQSLYLDEINDFINKVHLFGYHFATLDIR
QDSRIHHTVFSEIVTTLQKNGSNLFPKNYLELSENEQLNILSKVSDNIDISIFKDEMVTK
TLSSIHAVKTIQQSNGEKGANRYIISNNQTAVNVMETFAMFNLCDFKHNITVDIIPLFET
INDLTNATSVMKKLYTNTAYKKHLKNRNNKQTIMLGFSDGTKDGGYLMANWSIFKAKENL
TKISREHGIKVIFFDGRGGPPARGGGKTHQFYASLGPTIEDEEIQLTVQGQTISSNFGTL
DAAQYNIEQLLSSGISNELFSSTNNVMTKEDTEIMNDLALTSYEAYTNFKNHPKFLPYLE
RMSTLKYYAKTNIGSRPSKRSKSKKLNFADLRAIPFVGSWSQLKQNVPGFYGVGSALKKY
EDNGEFNKLKTFYNNSDFFKTLIGNSMMSLSKSFFELTKYMSEDEEFGAFWKLIYNEYKI
SKRLILKLSNYDELMQSNKVGKASIDIRENIVLPLLTIQQYALREIQKLQKQQNPDTNLI
KVYEKMVTRSLFGNINASRNSA
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaatcaccaaaacttacgaggtttaacgaaaatgtactcgcaaaataccaaatt
tacaatagtatttttatgacacttccgtttgatacaataacaaaaacaggcgttttgtta
ccactatttcatgatgtttgtgaaaatgggtttttaaacaaaaaaaatccaaccgaaatt
gtagaaaccttttttaaaacataccaagaaaacccaactgaaacagaaaaaataaattta
ttgtttaaatttattcaatacattgaacgtcaggttgttttatttgatgcaattgaagat
gcagcattcccaattgttaacaatatggatggtgttgggactttacggaatagcaaagaa
atggcctctttagaaaacaaaaaagaagatttaaaaaattatctcaaaaactttaaagtt
cgcgttgttttaacagctcacccaacacaattttatcctggaactgttttaggaattata
acagatttaacagaagctattgaaaataataatttattattaataaataaacttctagct
cagttgggaaaaactccgttttttaaacacgaaaagcccactccttttgatgaagccatt
aatttaatatggtatttagaaaatgtattctatcactcaatttcaaaagtatacagctat
attcaaagcaacatattaaacggggaactaattgataatgagataattaatttaggtttt
tggcctggaggtgatagagatggaaacccttttgttaccacacaaattactttagatgtt
gccaaacgtttaaaacaaaccattttaaaaaattattataaagatattcgtttattaaaa
aggcgtttaacttttgatggtgttgaacagcctattttagaattagaaaaaatgattttt
gaaaatagcgttaattctgattttaaaacactacttcctttaaacttgtttaaagaaaaa
ttatttcaaataaaagaaacacttattacaaaacaccaatctctttatttagatgaaatt
aacgattttatcaataaagtgcacttatttggatatcattttgcaacgttagatattcga
caagatagtagaatccatcacacagttttttcagaaattgtaacaactttacaaaaaaat
ggaagtaacttatttccaaaaaactatttagaactttcagaaaatgaacaactaaacatt
ctttcaaaagtttctgataacattgatatatctatttttaaagatgaaatggttaccaaa
acattaagctcaatacacgctgtaaaaaccattcagcaaagtaatggagaaaaaggcgca
aatcgctatattattagtaataaccaaactgccgtaaatgtaatggaaacatttgcaatg
tttaatttatgcgattttaaacacaatataaccgttgatattattccactttttgaaact
attaatgacttaacaaatgcaacgagtgttatgaaaaaattatacacaaacactgcctat
aaaaagcatttgaaaaatagaaataataaacaaactattatgcttggcttttctgacgga
acaaaagatggtggttatttaatggcaaactggtctatttttaaagcaaaagaaaactta
acaaaaatatctagagagcacggtataaaagttatcttttttgatggtcgtggtggccca
cctgctcgtggtggtggaaaaacacatcaattttatgcgtcattaggcccaaccattgaa
gatgaagaaatacaattaacggtacaaggacaaactattagctccaattttggaacctta
gatgctgctcaatacaatattgaacaattattaagttcaggaatttcaaacgaattattt
agtagtactaataatgttatgactaaagaagatactgaaattatgaatgatttggcatta
actagctatgaagcttataccaatttcaaaaaccatccaaaatttttaccatacttagaa
cgaatgagtactttaaaatattatgctaaaacgaatattggaagtcgaccttcaaaacgt
tctaaatctaaaaaattaaactttgcagatttacgtgctataccttttgttggctcttgg
agtcagctaaaacaaaatgttcctggtttttatggcgttggatctgctctaaaaaaatat
gaagataatggtgaatttaataaactaaaaacattttataataattccgattttttcaaa
acacttattggaaatagtatgatgtctctttcaaaatctttttttgaactaaccaaatat
atgagtgaagatgaagaatttggagctttttggaaacttatttacaatgaatataaaatt
tcgaaaaggcttattttaaaactttctaactatgatgaattaatgcaaagcaataaagtt
ggaaaagcatctatagatattcgcgaaaatattgtgctacctttactaaccatacaacaa
tatgcattgcgtgagattcagaaattacaaaaacaacaaaatcctgatactaatttaatt
aaagtatatgaaaaaatggtaactagatcattgtttggaaatattaacgcaagtagaaat
tcagcttaa

DBGET integrated database retrieval system