KEGG   Lutibacter profundi: Lupro_12070Help
Entry
Lupro_12070       CDS       T04235                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
lut  Lutibacter profundi
Pathway
lut00564  Glycerophospholipid metabolism
lut01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lut00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Lupro_12070
Enzymes [BR:lut01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     Lupro_12070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 HI0933_like GIDA Pyr_redox_2 NAD_binding_8 Pyr_redox_3 FAD_binding_3 Thi4
Motif
Other DBs
NCBI-ProteinID: AMC12266
UniProt: A0A120IEP0
LinkDB All DBs
Position
2743963..2745525
Genome map
AA seq 520 aa AA seqDB search
MNRENLVEKIDKREVIWDVIVIGGGASGLGIAIEAVTRGYKTLLLEQYDFTKGTSSRSTK
LVHGGVRYLAQGNISLVLESLKERGLLQKNAPHLVSNLAFLIPSYTWWGIPFYTIGLILY
DLLAGKLTFGKSKPQSKAKTLAKIPTLIKKNLRGSVLYHDGQFDDSRLGLNMAQTIIQKG
GTAINYVKVCGFLKEKGIISGVKAQDFETKIEYKIKAKTVINATGIFVDEILQKDNPKAK
DIVKPSQGVHLILNKEFLPNNYGLMIPKTKDGRVLFAVPWHNKVILGTTDVLKEVSVIEP
KATDEEINFILETAGRYLTKNPTRKDIKSVFAGLRPLAIPKKKGKKTKEISRGHKIYKSQ
SDLITIIGGKWTTYRQMGQDVINKMEFIKKLPKKNSITSSLHLYGYKEKTDFKDLLYFYG
SDIIYIKELILSNPTLDEWVSEILQIKKAQVVWACKNEMARTVEDVLARRTRALFLDAKE
SIRMSPIVAKIMANELGKNKEWENTQIEKYTALANSYFIK
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
ataaatagagaaaatttagtagaaaaaattgacaaacgagaggtaatttgggatgttatt
gttattggtggaggcgcttcgggtttaggaatagcaattgaagctgttacaagaggatat
aaaacattgcttttagaacaatatgattttacaaagggtacttcaagtagaagtacgaaa
ttggttcatggaggagttcgatatttagctcaagggaatatttctttagtgcttgaatct
ttaaaagaaagaggattactgcaaaaaaatgcgccacacttagtgtctaatcttgccttt
ttaattccttcgtacacttggtggggaataccattttatactattgggttaattttatac
gatttgttagctggaaaactaacttttggaaagtcaaaaccacaatcaaaggcaaaaaca
ttggctaaaatcccaacgttaatcaaaaagaatttaagaggaagtgtattgtatcatgat
ggacagtttgacgattcaaggttgggattgaatatggctcaaacaataattcaaaaggga
ggtacagctataaactatgtgaaagtttgtgggtttttgaaagaaaaaggtattattagt
ggcgttaaagctcaagattttgaaacaaaaattgagtataaaatcaaagcaaaaacagta
attaacgcaacaggtatttttgttgatgaaattttacaaaaagacaacccaaaagctaaa
gatattgtaaaacctagtcaaggtgtacacttaattctgaataaagaatttttaccaaat
aattatggtttaatgatacccaaaacaaaagatggaagagttttatttgctgtgccttgg
cataataaagttattttaggaacaacagatgtattaaaagaagtttcggtaattgagcct
aaagctacagatgaagaaattaattttattttagaaacagctggaagatatttaactaag
aatccaacgcgaaaagatataaaaagtgtttttgcgggtcttaggcctttggctatccca
aaaaagaaaggaaagaaaacaaaagaaatttctagaggtcataaaatttataaatctcaa
tcagatttaattactataattggaggtaaatggacaacataccgtcaaatggggcaagac
gttattaataaaatggaatttattaaaaaattaccaaaaaaaaactcgataacatcttct
ttacatttgtatggatataaagagaagacagattttaaagatttactttacttttatggt
tcagatataatttatattaaagaattaattttatcgaacccaacgttagatgaatgggta
agtgaaattttacaaataaaaaaagcacaagttgtttgggcttgtaaaaatgaaatggct
agaacggttgaagatgttttagcaagaagaacaagagctttgtttttagatgctaaagaa
agtattagaatgtccccaatagttgctaaaattatggccaatgaattgggcaaaaacaaa
gagtgggaaaatacacaaatagaaaaatatacagcgttggcaaatagctatttcataaaa
taa

DBGET integrated database retrieval system