KEGG   Lutibacter profundi: Lupro_12360Help
Entry
Lupro_12360       CDS       T04235                                 

Definition
(GenBank) hypothetical protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lut  Lutibacter profundi
Pathway
lut00010  Glycolysis / Gluconeogenesis
lut00020  Citrate cycle (TCA cycle)
lut00620  Pyruvate metabolism
lut01100  Metabolic pathways
lut01110  Biosynthesis of secondary metabolites
lut01120  Microbial metabolism in diverse environments
lut01130  Biosynthesis of antibiotics
lut01200  Carbon metabolism
Module
lut_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lut00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lupro_12360
   00020 Citrate cycle (TCA cycle)
    Lupro_12360
   00620 Pyruvate metabolism
    Lupro_12360
Enzymes [BR:lut01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Lupro_12360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 DUF2118 GCV_H
Motif
Other DBs
NCBI-ProteinID: AMC12005
UniProt: A0A0X8G8I3
LinkDB All DBs
Position
complement(2813685..2814932)
Genome map
AA seq 415 aa AA seqDB search
MAEIITMPRLSDTMTEGVVAQWLKKVGDKVSEGDILAEIETDKATMEFESFNEGTLLYIG
LNEGETAPVDSLLAIIGEEGEDINKIIEDFKVKTSEQESTPVKEEQPKPEINTPKKEVSI
STQPTHNEEISDSGRIIASPLAKKMAKEKGINLNSITGSGENGRVIKRDIENYVPTVTTA
TSNLPIAGEESFEESTNSQMRKTIARRLAESKFTAPHYYLMIDIDMDNAIASRKAINELP
DTKVSFNDIIVKASAMALKKHPKVNSQWFDDRTRVNHYVNIGVAVAVEDGLVVPVIPFTD
QKSMTQIGNEVKDMALRAKTKKLTPAEMEGSTFTVSNLGMFGISEFTSIINQPNSAILSV
GAIIQKPVVKNGEIVVGNTMKVTLACDHRTVDGATGSAFLQTLKQFIENPVTMLA
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaattataacaatgccccgattaagtgatacaatgactgaaggagttgttgct
caatggttaaaaaaagttggtgacaaagtttcagaaggcgacattctagctgaaattgaa
acagataaagccaccatggaatttgaatctttcaatgaaggtacacttttatacattggt
ttaaatgaaggtgaaactgcaccagtagactctttattagccattataggtgaggaaggt
gaagatattaataaaataattgaagattttaaagttaaaacttctgaacaagaaagtaca
cctgtaaaagaagaacagccaaaacctgaaattaacacacctaagaaagaggtttctatt
agcactcagccaactcataatgaggaaattagtgattctggaagaattattgcttcacca
ctggcaaaaaaaatggccaaagaaaaaggaattaatttaaattcaattactggatctggt
gaaaatggtagagttataaaacgtgatattgagaactacgttcctactgtaacaactgct
acaagtaatttgccaattgcaggtgaagaaagttttgaagaaagcactaattcgcaaatg
cgtaaaactattgctagaagattggccgaatcaaaatttacggctcctcactattattta
atgattgatattgatatggataacgctatagcttctagaaaagctataaacgaactccct
gacaccaaagtatcattcaatgatattatagtaaaagcaagtgcaatggcattaaaaaaa
caccctaaagtaaattcccagtggtttgatgatagaactcgtgttaatcactatgttaat
attggtgttgctgttgctgttgaagatggattagttgtacctgtgattccttttactgat
caaaaaagtatgactcaaattggaaatgaagtgaaagatatggctctaagagctaaaaca
aaaaaattgactcctgcagaaatggaaggaagcacatttacagtttctaatttaggtatg
tttggtatttcagaatttacctccattataaaccagccaaattctgctattttatcagtt
ggtgcaattattcaaaaacccgttgttaaaaatggagagattgttgttggaaacactatg
aaagtaacattagcttgcgaccacagaacagttgatggcgcaactggatctgcattttta
caaaccttaaagcaatttattgaaaatccggttactatgttagcataa

DBGET integrated database retrieval system