KEGG   Lipotes vexillifer (Yangtze River dolphin): 103069012
Entry
103069012         CDS       T03090                                 

Gene name
IL4
Definition
(RefSeq) interleukin 4
  KO
K05430  interleukin 4
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04060  Cytokine-cytokine receptor interaction
lve04151  PI3K-Akt signaling pathway
lve04630  JAK-STAT signaling pathway
lve04640  Hematopoietic cell lineage
lve04657  IL-17 signaling pathway
lve04658  Th1 and Th2 cell differentiation
lve04659  Th17 cell differentiation
lve04660  T cell receptor signaling pathway
lve04664  Fc epsilon RI signaling pathway
lve04672  Intestinal immune network for IgA production
lve05140  Leishmaniasis
lve05200  Pathways in cancer
lve05310  Asthma
lve05320  Autoimmune thyroid disease
lve05321  Inflammatory bowel disease
lve05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    103069012 (IL4)
   04151 PI3K-Akt signaling pathway
    103069012 (IL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103069012 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    103069012 (IL4)
   04660 T cell receptor signaling pathway
    103069012 (IL4)
   04658 Th1 and Th2 cell differentiation
    103069012 (IL4)
   04659 Th17 cell differentiation
    103069012 (IL4)
   04657 IL-17 signaling pathway
    103069012 (IL4)
   04664 Fc epsilon RI signaling pathway
    103069012 (IL4)
   04672 Intestinal immune network for IgA production
    103069012 (IL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103069012 (IL4)
  09163 Immune disease
   05310 Asthma
    103069012 (IL4)
   05320 Autoimmune thyroid disease
    103069012 (IL4)
   05321 Inflammatory bowel disease
    103069012 (IL4)
   05330 Allograft rejection
    103069012 (IL4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    103069012 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:lve04052]
    103069012 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:lve00536]
    103069012 (IL4)
Cytokines and growth factors [BR:lve04052]
 Cytokines
  Interleukins
   103069012 (IL4)
Glycosaminoglycan binding proteins [BR:lve00536]
 Heparan sulfate / Haparin
  Cytokines
   103069012 (IL4)
SSDB
Motif
Pfam: IL4 AAR2 DUF4798
Other DBs
NCBI-GeneID: 103069012
NCBI-ProteinID: XP_007461399
UniProt: A0A340XPY0
LinkDB
Position
Un
AA seq 133 aa
MGLTSQLIPMLVCLLACTSNFVHGHKCDITLQEIIKTLNILTARKNLCMELPVEDVFATT
KNTTEKETFCRAATVLWHIYRYHKCLNKHLSGLHRNLSSMANMTCSVNEAKKSTLKDFLE
RLKTIMKEKYSKC
NT seq 402 nt   +upstreamnt  +downstreamnt
atgggtctcacctcccaactgatcccaatgctagtctgcttactggcatgtaccagcaac
ttcgtccatggacacaagtgcgatattaccttacaagagatcatcaaaacgctgaacatc
ctcacagcaagaaagaacttgtgcatggagctgcctgtagaagacgtctttgccaccaca
aagaacacaactgagaaggaaactttctgcagggccgcgactgtgctttggcatatctac
agataccacaagtgcttgaacaaacacctgagtggacttcacaggaacctcagcagcatg
gcaaacatgacctgttctgtgaatgaagccaagaagagtacgttgaaagacttcttggaa
aggctaaagacgattatgaaggagaaatactcaaagtgttga

DBGET integrated database retrieval system