KEGG   Lipotes vexillifer (Yangtze River dolphin): 103069014Help
Entry
103069014         CDS       T03090                                 

Gene name
SOD2
Definition
(RefSeq) superoxide dismutase 2
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04068  FoxO signaling pathway
lve04146  Peroxisome
lve04211  Longevity regulating pathway
lve04213  Longevity regulating pathway - multiple species
lve05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:lve00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103069014 (SOD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    103069014 (SOD2)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    103069014 (SOD2)
   04213 Longevity regulating pathway - multiple species
    103069014 (SOD2)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05016 Huntington disease
    103069014 (SOD2)
Enzymes [BR:lve01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     103069014 (SOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 103069014
NCBI-ProteinID: XP_007461827
UniProt: A0A340XNV4
LinkDB All DBs
Position
Un
AA seq 222 aa AA seqDB search
MLCRAACSTSWKLVPGLGALGSRRKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVN
NLNIAEEKYREALEKGDVTAQVALQPAVKFNGGGHINHSIFWTNLSPNGGGEPEGELLEA
IKHDFGSFKNFKEKLTAVSVGVQGSGWGWLGFSKEQGRLQIAACSNQDPLQGTTGLIPLL
GIDVWEHAYYLQYKNVRPDYLKAIWNVISWENVAARYTACKK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgttgtgccgggcggcgtgcagcacaagctggaagctggtgccgggcctgggggctctg
ggctcccggcggaagcatagcctccccgacctgccgtacgactatggcgccctggagccc
cacatcaacgcgcagatcatgcagctgcatcacagcaagcaccatgcggcctacgtgaac
aacctgaacatcgccgaggagaaatatcgggaggcgctggagaagggtgatgttacagct
caggtggctctacagcctgcagtaaagttcaacggtggaggccatatcaatcatagcatt
ttctggacaaatctgagccctaatggtggtggagaacccgaaggggagttgctggaagcc
atcaaacatgactttggttccttcaagaactttaaggagaagttgaccgccgtgtccgtt
ggtgtccaaggctcaggctggggttggctcggtttcagtaaggaacagggacgcttacag
attgctgcttgttctaaccaggatcccctgcaaggaacaacaggtcttattccactgctg
ggaattgatgtgtgggagcatgcttattaccttcagtataaaaatgtcaggcctgattat
ctgaaagccatttggaatgtaatcagctgggagaatgtagctgcgagatacacggcttgc
aaaaagtaa

DBGET integrated database retrieval system