KEGG   Lipotes vexillifer (Yangtze River dolphin): 103069101
Entry
103069101         CDS       T03090                                 

Gene name
ATF6B
Definition
(RefSeq) activating transcription factor 6 beta
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
lve  Lipotes vexillifer (Yangtze River dolphin)
Pathway
lve04022  cGMP-PKG signaling pathway
lve04141  Protein processing in endoplasmic reticulum
lve04151  PI3K-Akt signaling pathway
lve04211  Longevity regulating pathway
lve04261  Adrenergic signaling in cardiomyocytes
lve04668  TNF signaling pathway
lve04728  Dopaminergic synapse
lve04911  Insulin secretion
lve04915  Estrogen signaling pathway
lve04918  Thyroid hormone synthesis
lve04925  Aldosterone synthesis and secretion
lve04926  Relaxin signaling pathway
lve04927  Cortisol synthesis and secretion
lve04928  Parathyroid hormone synthesis, secretion and action
lve04934  Cushing syndrome
lve04935  Growth hormone synthesis, secretion and action
lve05020  Prion disease
lve05030  Cocaine addiction
lve05031  Amphetamine addiction
lve05034  Alcoholism
lve05161  Hepatitis B
lve05163  Human cytomegalovirus infection
lve05166  Human T-cell leukemia virus 1 infection
lve05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:lve00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103069101 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    103069101 (ATF6B)
   04022 cGMP-PKG signaling pathway
    103069101 (ATF6B)
   04151 PI3K-Akt signaling pathway
    103069101 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    103069101 (ATF6B)
   04915 Estrogen signaling pathway
    103069101 (ATF6B)
   04926 Relaxin signaling pathway
    103069101 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    103069101 (ATF6B)
   04918 Thyroid hormone synthesis
    103069101 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    103069101 (ATF6B)
   04925 Aldosterone synthesis and secretion
    103069101 (ATF6B)
   04927 Cortisol synthesis and secretion
    103069101 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    103069101 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    103069101 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    103069101 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    103069101 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    103069101 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    103069101 (ATF6B)
   05031 Amphetamine addiction
    103069101 (ATF6B)
   05034 Alcoholism
    103069101 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    103069101 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103069101 (ATF6B)
   05161 Hepatitis B
    103069101 (ATF6B)
   05163 Human cytomegalovirus infection
    103069101 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lve03000]
    103069101 (ATF6B)
Transcription factors [BR:lve03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    103069101 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF4407 GIT_CC ZapB YabA Docking
Other DBs
NCBI-GeneID: 103069101
NCBI-ProteinID: XP_007459587
UniProt: A0A340XHL9
LinkDB
Position
Un
AA seq 709 aa
MAELMLLSEIADPTRFFTDNLLSPEDWGARNSTLYAGLDEVAEEQTQLFLCPEQDVPFGS
SSLDLGMDVSPPEPPWDSLPIFPDLQVKSEPSSPCSSSSLSSESSRLSAEPSSQASGVGE
VLVVKSESLTPSLCLLGDDPTSPFETVQINVGPTSDDASDVQIKIEPVSPSSSINSEASL
LSAESPNQAFIGEEVLEVKTESPSPQGCLLRDVSGPPLGAVQISMGLSSDGSSGKPLPAR
KPPLQPKPVVITTVPMPPRAVPPSTTVLLQPLVQPPPVSPVVLIQGAIRVQPEGVTPPAP
RPERKSIVPAPLPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQGLEARLQAV
LADNQQLRRENAALRRRLEALLAENSELKLGSGNRKVVCIMVFLLFIAFNFGPVSISEPP
PAPISPRMSREEPRPQRHLLEFSAQEPVHRVEHPQHPSQGPKETQPSSTGQPSFRNLTAF
PGGTKELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKMPQRPQERQKS
QLWKKSPPVKAVPTQPPGPPERDAVGQLQLYRQPDRSQPEFLDAIDRREDTFYVVSFRRD
HLLLPAISHNKTSRPKMSLVMPAMAPNETLSGRGPPGDYEEMMQIECEVMDTRVIHIKTS
TVPPSLRKQPSSSPGNATGGPLPASAASQTHQATHQPSTSIIPDLYDSH
NT seq 2130 nt   +upstreamnt  +downstreamnt
atggcggagctgatgctcctcagcgagattgcggacccgacgcgctttttcaccgacaat
ttgctgagcccggaggactggggtgcgcggaacagcaccttatacgccggcctggatgaa
gtggccgaggagcagacgcagctcttcctttgcccggagcaggatgtcccgtttggcagc
agttccctggacttggggatggatgtcagccctcctgaacccccctgggactctctgcct
atcttcccggatcttcaggtgaagtctgagccatcctccccctgctcttcctcctccctc
agctctgaatcgtcgcgcctttctgcagagccctccagccaggcctctggtgtaggggag
gtgctggtcgtgaagtcagagtccttgacaccctcactctgcctcctgggagatgatcca
acatccccatttgaaaccgtccagatcaatgtgggccccacctctgatgatgcctcagat
gtccagattaagatagagcctgtctctccatcttcctccatcaactcagaggcttccctg
ctctctgcggagtcccccaaccaggcttttataggagaggaggtactggaagtgaagaca
gagtccccatcccctcaagggtgtctcttgcgggatgtctcaggccccccacttggagct
gtccagatcagcatgggcctgtcctctgatggctcctcaggcaaacccctgcccgcccgg
aagccaccactgcagcccaaacctgtggtgataaccactgtcccgatgccaccgagagct
gtgcctcccagcaccactgtccttttgcagccccttgtccagccacccccagtgtcccca
gttgttctcatccaaggtgctattcgagtccagcccgagggagtgaccccccctgctcca
cggcctgagaggaagagcattgttccagctcctctgccagggaactcctgcccgcctgag
gtggatgcaaagctgctgaagcggcagcagcgaatgatcaagaaccgggagtcggcctgc
cagtcccggaggaagaagaaagagtatctgcaggggctggaagctcggctgcaggcggtg
ttggccgacaaccagcagctccggcgggagaatgctgccctccgccggcggctggaggcc
ctgctggccgagaacagcgagctcaagttagggtctggaaacaggaaggtggtctgcatc
atggtcttccttctcttcattgccttcaactttgggcctgtcagcatcagtgagcctcct
ccagctcccatctctcctcggatgagcagagaggagcctcgaccccagagacacttgctg
gagttctcggcacaagagccagttcacagagtagagcacccccagcatccctcccagggt
cccaaggagacccagcccagctccacgggccagccaagtttcaggaacctgacagccttc
cctgggggcaccaaggagctgctgctgagagacctggaccagctcttcctctcctctgat
tgccggcacttcaaccgaaccgagtccctgaggcttgctgatgagctgagtggctgggtc
cagcgccaccagagaggccggcggaagatgccccagaggccccaggagagacagaagtct
cagctatggaagaagtcgcctccagttaaggcagtccccacccaaccccctgggccccca
gaaagggatgctgtgggccagctgcagctatatcgccaaccagaccgttcgcagccagag
ttcctggatgcaattgaccgacgggaagacacattttatgttgtctccttccgaagagac
cacttgctgctcccagccatcagccacaacaagacctctcggcccaagatgtccctggtg
atgcccgccatggcccccaatgagaccctgtcaggccgggggcccccgggagactatgag
gagatgatgcagatcgaatgtgaggtcatggacaccagggtgatccacatcaagacctcc
acggtgcccccctcactccgaaaacagccgtcctcaagcccgggcaatgccacaggcggc
cccttgccagcttctgcagccagccagacccaccaggccacccatcagccctctacctca
atcatccctgacctctacgactcacactga

DBGET integrated database retrieval system